![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pavir.J339500.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 125aa MW: 13870.7 Da PI: 5.4816 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 78.3 | 1.2e-24 | 38 | 96 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl+k++++++d+ +++++sw e+g +fvv+ + ef++++Lp+yFkh+nf+SFvRQLn+Y
Pavir.J339500.1.p 38 FLTKTFQLVDDPCTDHVVSWGEDGATFVVWRPPEFSRDLLPNYFKHNNFSSFVRQLNTY 96
9*********************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 3.9E-27 | 28 | 97 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 1.3E-23 | 34 | 110 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 1.77E-22 | 37 | 96 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 7.0E-21 | 38 | 96 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.3E-15 | 38 | 61 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.3E-15 | 76 | 88 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.3E-15 | 89 | 101 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 125 aa Download sequence Send to blast |
MAFLVERCGS GGGEMAVSMD VETSSQSHAA KPVVPAPFLT KTFQLVDDPC TDHVVSWGED 60 GATFVVWRPP EFSRDLLPNY FKHNNFSSFV RQLNTYVSDW LRVCVHVRAS ALDLHCTFIF 120 LTAD* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5u_B | 8e-18 | 11 | 112 | 4 | 100 | Heat shock factor protein 1 |
| 5d5v_B | 8e-18 | 11 | 112 | 4 | 100 | Heat shock factor protein 1 |
| 5d5v_D | 8e-18 | 11 | 112 | 4 | 100 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269|PubMed:16202242}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Pavir.J339500.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC243249 | 1e-111 | AC243249.1 Panicum virgatum clone PV_ABa094-D05, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025797236.1 | 3e-55 | heat stress transcription factor B-4d-like | ||||
| Swissprot | Q7XHZ0 | 1e-44 | HFB4B_ORYSJ; Heat stress transcription factor B-4b | ||||
| TrEMBL | A0A2T7CC94 | 5e-54 | A0A2T7CC94_9POAL; Uncharacterized protein | ||||
| STRING | Pavir.Ib01755.1.p | 3e-54 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP121 | 37 | 394 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G46264.1 | 1e-38 | heat shock transcription factor B4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Pavir.J339500.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




