![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pbr000388.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 118aa MW: 12930.4 Da PI: 5.2777 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 71.6 | 1.4e-22 | 70 | 117 | 1 | 48 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48
+C+v++C+adls++k+y+rrhkvC+vh+kap+vl+ g qrfCqqCsr
Pbr000388.1 70 CCKVDSCNADLSDLKQYYRRHKVCDVHAKAPAVLMGGFLQRFCQQCSR 117
6**********************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 2.2E-23 | 64 | 117 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 19.751 | 68 | 117 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 1.44E-21 | 69 | 117 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 4.3E-18 | 71 | 117 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 118 aa Download sequence Send to blast |
MEPGRAHGKK TLVKYEEEEE EEEEEESRSG TPSIVDGEDE RRDTVMMMNS TAPSPTGRRS 60 GAGGSTAGPC CKVDSCNADL SDLKQYYRRH KVCDVHAKAP AVLMGGFLQR FCQQCSR* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj0_A | 8e-20 | 67 | 117 | 2 | 52 | squamosa promoter-binding protein-like 12 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Pbr000388.1 |
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KF673852 | 1e-153 | KF673852.1 Malus domestica cultivar Fuji SBP-box transcription factor (SPL2) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009342532.1 | 1e-82 | PREDICTED: squamosa promoter-binding-like protein 3 | ||||
| Swissprot | Q38740 | 1e-20 | SBP2_ANTMA; Squamosa promoter-binding protein 2 | ||||
| TrEMBL | A0A498JUM1 | 2e-63 | A0A498JUM1_MALDO; Uncharacterized protein | ||||
| STRING | XP_009342532.1 | 4e-82 | (Pyrus x bretschneideri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF535 | 34 | 153 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G60030.1 | 6e-21 | squamosa promoter-binding protein-like 12 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




