![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pbr001458.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 117aa MW: 13371.3 Da PI: 9.1062 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 93.2 | 1.2e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
+rien+s rqvtfskRr+g+lKKA+ELSvLCdaevaviifs++ k+ye++s
Pbr001458.1 9 ERIENNSSRQVTFSKRRKGLLKKAYELSVLCDAEVAVIIFSQKAKIYEFAS 59
69***********************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 31.202 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 5.6E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.0E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 5.89E-33 | 3 | 87 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 8.40E-42 | 3 | 78 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.2E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.0E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.0E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 117 aa Download sequence Send to blast |
MVRGKIEMER IENNSSRQVT FSKRRKGLLK KAYELSVLCD AEVAVIIFSQ KAKIYEFASS 60 DMQRTINRYH KHENGSGQTN KVEVEQYVQI DGLGNEQMQY MREVLNPLCG AFAVHL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6bz1_A | 3e-22 | 1 | 85 | 1 | 86 | MEF2 CHIMERA |
| 6bz1_B | 3e-22 | 1 | 85 | 1 | 86 | MEF2 CHIMERA |
| 6bz1_C | 3e-22 | 1 | 85 | 1 | 86 | MEF2 CHIMERA |
| 6bz1_D | 3e-22 | 1 | 85 | 1 | 86 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Pbr001458.1 |
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KP164006 | 1e-143 | KP164006.1 Pyrus pyrifolia clone PpSOC1-1 SOC1 MADS-box protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009341296.1 | 5e-58 | PREDICTED: MADS-box protein AGL42-like isoform X5 | ||||
| Refseq | XP_018501073.1 | 6e-58 | PREDICTED: MADS-box protein AGL42-like isoform X1 | ||||
| Swissprot | Q9FIS1 | 4e-34 | AGL42_ARATH; MADS-box protein AGL42 | ||||
| TrEMBL | A0A0D4ZY40 | 2e-55 | A0A0D4ZY40_PYRPY; SOC1 MADS-box protein | ||||
| STRING | XP_009347897.1 | 5e-58 | (Pyrus x bretschneideri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF119 | 33 | 360 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G62165.4 | 2e-36 | AGAMOUS-like 42 | ||||




