PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pbr004500.1

Organism

Pyrus bretschneideri

Taxonomic ID

225117

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus

Family

NAC

Protein Properties

Length: 168aa MW: 19092 Da PI: 9.5735

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pbr004500.1	genome	CPETR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	164.8	3e-51	14	138	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 lppGfrFhPtdeelv +yL++kv + +l++ ++i+evd++k++PwdLp +e yfFs+r+ ky++g+r+nrat sgyWkatg dk++++ +g Pbr004500.1 14 LPPGFRFHPTDEELVLQYLRRKVYSCPLPA-SIIPEVDVCKADPWDLPGD---CAQERYFFSTREAKYPNGNRSNRATGSGYWKATGLDKQIVTCrGG 107 79**************************.89***********44...35799*****************************9876589 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 ++vg+kktLvfy+g+ p+g++tdW+mheyrl Pbr004500.1 108 QVVGIKKTLVFYRGKPPHGTRTDWIMHEYRL 138 99*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.62E-57	10	144	IPR003441	NAC domain
PROSITE profile	PS51005	53.805	14	163	IPR003441	NAC domain
Pfam	PF02365	3.8E-27	15	138	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 168 aa Download sequence Send to blast
MERINFVKNG VLRLPPGFRF HPTDEELVLQ YLRRKVYSCP LPASIIPEVD VCKADPWDLP 60 GDCAQERYFF STREAKYPNG NRSNRATGSG YWKATGLDKQ IVTCRGGQVV GIKKTLVFYR 120 GKPPHGTRTD WIMHEYRLVL PENPASVAPP EKNATQVSFL FYLVLFQ*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3swm_A	5e-49	12	141	18	148	NAC domain-containing protein 19
3swm_B	5e-49	12	141	18	148	NAC domain-containing protein 19
3swm_C	5e-49	12	141	18	148	NAC domain-containing protein 19
3swm_D	5e-49	12	141	18	148	NAC domain-containing protein 19
3swp_A	5e-49	12	141	18	148	NAC domain-containing protein 19
3swp_B	5e-49	12	141	18	148	NAC domain-containing protein 19
3swp_C	5e-49	12	141	18	148	NAC domain-containing protein 19
3swp_D	5e-49	12	141	18	148	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269\|PubMed:20388856, ECO:0000269\|PubMed:21673078, ECO:0000269\|PubMed:24442717}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Pbr004500.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269\|PubMed:21673078}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001281000.1	1e-112	NAC transcription factor 25-like
Swissprot	Q9FY93	1e-85	NAC83_ARATH; NAC domain-containing protein 83
TrEMBL	A0A498HN02	1e-111	A0A498HN02_MALDO; Uncharacterized protein
TrEMBL	D9ZJA0	1e-111	D9ZJA0_MALDO; NAC domain class transcription factor
STRING	XP_009349483.1	1e-123	(Pyrus x bretschneideri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF704	34	139

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G13180.1	5e-88	NAC domain containing protein 83

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]