![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pbr008076.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 76aa MW: 8696.35 Da PI: 10.9572 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 93.3 | 1.2e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
kri++k++rqvtfskRr+g++KKA ELSvLC++ev ++ifs++g+lye++s
Pbr008076.1 9 KRIDDKIRRQVTFSKRRTGLMKKARELSVLCGVEVGLVIFSPKGRLYEFCS 59
79***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 3.1E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 30.081 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.7E-28 | 2 | 66 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.85E-36 | 2 | 63 | No hit | No description |
| PRINTS | PR00404 | 1.1E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.2E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 76 aa Download sequence Send to blast |
MGRGKVQLKR IDDKIRRQVT FSKRRTGLMK KARELSVLCG VEVGLVIFSP KGRLYEFCSG 60 ERYAPLNFFF LPPPY* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 2e-18 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 2e-18 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 2e-18 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 2e-18 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 2e-18 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 2e-18 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 2e-18 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 2e-18 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 2e-18 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 2e-18 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269|PubMed:9339904, ECO:0000269|Ref.9}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Pbr008076.1 |
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KP164015 | 5e-94 | KP164015.1 Pyrus pyrifolia clone PpFLC FLC-like MADS-box protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_028957757.1 | 7e-37 | truncated transcription factor CAULIFLOWER A-like isoform X1 | ||||
| Swissprot | Q9SAR1 | 2e-25 | MADS8_ORYSJ; MADS-box transcription factor 8 | ||||
| TrEMBL | A0A2P6S6L4 | 3e-36 | A0A2P6S6L4_ROSCH; Putative transcription factor MADS-type1 family | ||||
| STRING | XP_009344924.1 | 2e-34 | (Pyrus x bretschneideri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF119 | 33 | 360 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G30260.1 | 8e-28 | AGAMOUS-like 79 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




