PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pbr016134.1

Organism

Pyrus bretschneideri

Taxonomic ID

225117

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus

Family

Dof

Protein Properties

Length: 164aa MW: 18274.8 Da PI: 9.6113

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pbr016134.1	genome	CPETR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	121.3	3.4e-38	44	102	2	60
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 ++++++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k Pbr016134.1 44 PDRIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKTKP 102 67899***************************************************985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	2.0E-29	43	101	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	9.6E-32	47	101	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	28.369	48	102	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	50	86	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010214	Biological Process	seed coat development
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:1902455	Biological Process	negative regulation of stem cell population maintenance
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 164 aa Download sequence Send to blast
MAQVQTGQDV HGIKLFGRTI TLQNRSSQVK EEPKKDEQTV EKRPDRIIPC PRCKSMETKF 60 CYFNNYNVNQ PRHFCKGCQR YWTAGGALRN VPVGAGRRKT KPPCRGLAGL PEGCIYEGSD 120 VVHQFELDGV VEEWHVAAAQ GSFHQVFPVV KRRRSGSGGQ PCS*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269\|PubMed:19619493}.
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269\|PubMed:19619493}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00166	DAP	Transfer from AT1G29160	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Pbr016134.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269\|PubMed:19619493}.
UniProt	INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269\|PubMed:19619493}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009352774.1	1e-120	PREDICTED: dof zinc finger protein DOF1.5-like
Swissprot	O22967	2e-57	CDF4_ARATH; Cyclic dof factor 4
Swissprot	P68350	2e-57	DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBL	A0A498ISQ3	1e-115	A0A498ISQ3_MALDO; Uncharacterized protein
STRING	XP_009352774.1	1e-119	(Pyrus x bretschneideri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF6483	32	51

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G34140.1	8e-60	Dof family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Bueso E, et al. Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration. Plant J., 2016. 87(6): p. 583-96 [PMID:27227784]