![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pbr017593.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 59aa MW: 6247.04 Da PI: 8.5225 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 67.9 | 1.9e-21 | 13 | 58 | 2 | 48 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvts 48
r+qdrflPi nvsrimk+ Panakiskdaketv+ec+sefisf+t+
Pbr017593.1 13 RKQDRFLPI-NVSRIMKNGSPANAKISKDAKETVKECISEFISFITG 58
89******9.9**********************************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.9E-18 | 7 | 57 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.87E-11 | 13 | 57 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 4.5E-12 | 18 | 57 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 59 aa Download sequence Send to blast |
MADSDNDSGG GARKQDRFLP INVSRIMKNG SPANAKISKD AKETVKECIS EFISFITG* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 2e-17 | 8 | 58 | 2 | 53 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Pbr017593.1 |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017256660.1 | 3e-25 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
| Refseq | XP_021978207.1 | 8e-25 | nuclear transcription factor Y subunit B-3-like | ||||
| Swissprot | O23310 | 8e-26 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
| TrEMBL | A0A0J8BLH6 | 2e-24 | A0A0J8BLH6_BETVU; Uncharacterized protein | ||||
| STRING | LPERR07G18740.1 | 1e-24 | (Leersia perrieri) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 3e-28 | nuclear factor Y, subunit B3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




