PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr019213.1
Organism
Pyrus bretschneideri
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 75aa    MW: 8475.71 Da    PI: 6.51
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr019213.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM561.4e-171867150
          NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkk 50
                 lp+GfrFhPt+eel+++yLk k++g +  + ++i+ev+i+++ePwdLp +
  Pbr019213.1 18 LPVGFRFHPTEEELISHYLKLKLRGMDSLVGDAIREVNICNYEPWDLPGN 67
                 79*************************999899**************943 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-18769IPR003441NAC domain
PROSITE profilePS5100519.8131874IPR003441NAC domain
PfamPF023652.1E-71962IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 75 aa     Download sequence    Send to blast
MASNGIRFTR VQVGDLLLPV GFRFHPTEEE LISHYLKLKL RGMDSLVGDA IREVNICNYE  60
PWDLPGNFLQ NSRS*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator essential for the anti-viral defense called virus basal resistance response pathway (PubMed:11041886, PubMed:15629774, PubMed:18785827, PubMed:24418554). Not involved in HRT-mediated hypersensitive response (HR) and resistance to TCV (PubMed:18785827). Binds DNA non specifically (PubMed:15629774). Activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). {ECO:0000250|UniProtKB:Q9SCK6, ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774, ECO:0000269|PubMed:18785827, ECO:0000269|PubMed:24418554}.; FUNCTION: (Microbial infection) Compromised function in defense response pathway when interacting with the invading viral capsid protein (CP) of turnip crinkle virus (TCV) due to abnormal subcellular localization. {ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr019213.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by bacterial pathogens type III effector proteins (TTEs). {ECO:0000269|PubMed:16553893}.; INDUCTION: (Microbial infection) Accumulates 2 days post infection with turnip crinkle virus (TCV) (PubMed:24418554). {ECO:0000269|PubMed:24418554}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009376040.18e-40PREDICTED: NAC domain-containing protein 4-like isoform X1
RefseqXP_009376041.18e-40PREDICTED: NAC domain-containing protein 4-like isoform X2
SwissprotQ9LKG82e-15NAC91_ARATH; NAC domain-containing protein 91
TrEMBLA0A498JJR88e-28A0A498JJR8_MALDO; Uncharacterized protein
STRINGXP_009376040.13e-39(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114331739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24590.21e-17TCV-interacting protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ben Daniel BH, et al.
    Identification of novel transcriptional regulators of Zat12 using comprehensive yeast one-hybrid screens.
    Physiol Plant, 2016. 157(4): p. 422-41
    [PMID:26923089]
  3. Li Y, et al.
    The interaction between Turnip crinkle virus p38 and Cucumber mosaic virus 2b and its critical domains.
    Virus Res., 2016. 222: p. 94-105
    [PMID:27288723]