PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pbr019908.1

Organism

Pyrus bretschneideri

Taxonomic ID

225117

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus

Family

MYB

Protein Properties

Length: 200aa MW: 23129.2 Da PI: 9.9792

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pbr019908.1	genome	CPETR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	65	1.5e-20	15	62	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd++l+++++ +G+++Wk+Ia + g++R++k+c++rw +yl Pbr019908.1 15 RGSWTAEEDQKLAQVIEIHGPRRWKSIATKAGLKRCGKSCRLRWMNYL 62 89********************************************97 PP
2	Myb_DNA-binding	50.8	3.9e-16	68	113	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Pbr019908.1 68 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 113 78999***************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	26.075	10	66	IPR017930	Myb domain
SMART	SM00717	8.4E-17	14	64	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	2.35E-29	14	109	IPR009057	Homeodomain-like
Pfam	PF00249	3.1E-19	15	62	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.7E-25	16	69	IPR009057	Homeodomain-like
CDD	cd00167	3.78E-12	17	62	No hit	No description
SMART	SM00717	1.9E-15	67	115	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	20.433	67	117	IPR017930	Myb domain
Pfam	PF00249	1.6E-14	68	113	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.5E-25	70	118	IPR009057	Homeodomain-like
CDD	cd00167	4.69E-10	72	113	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 200 aa Download sequence Send to blast
MVPVSSRSSK KEGNRGSWTA EEDQKLAQVI EIHGPRRWKS IATKAGLKRC GKSCRLRWMN 60 YLRPNIKRGN ISDQEEDLIL RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN SHLSKKMKQN 120 RAVSKTVQGS TEQKNIKAMD VNALTIERQD AFKHEENFNF GFNGDEFFNC SSSEQGPLNL 180 EWMNTFLEMD ESWFTLHEI*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	1e-29	12	117	24	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269\|PubMed:10589676, ECO:0000269\|PubMed:11585796, ECO:0000269\|PubMed:14627722, ECO:0000269\|PubMed:15361138, ECO:0000269\|PubMed:15795220, ECO:0000269\|PubMed:16207757}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Pbr019908.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269\|PubMed:11910008, ECO:0000269\|PubMed:16176989}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY115511	1e-47	AY115511.1 Gossypioides kirkii myb-like transcription factor 3 (MYB3) gene, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018505093.1	1e-147	PREDICTED: transcription factor MYB114-like
Swissprot	Q9SEI0	5e-52	WER_ARATH; Transcription factor WER
TrEMBL	A0A498HV10	1e-138	A0A498HV10_MALDO; Uncharacterized protein
STRING	XP_009362719.1	1e-147	(Pyrus x bretschneideri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2148	32	88

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G14750.1	2e-54	myb domain protein 66

Publications ? help Back to Top
Savage N, et al. Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana. PLoS ONE, 2013. 8(10): p. e75452 [PMID:24130712] Cheng Y, et al. Brassinosteroids control root epidermal cell fate via direct regulation of a MYB-bHLH-WD40 complex by GSK3-like kinases. Elife, 2018. [PMID:24771765] Kiefer CS, et al. Correction: Arabidopsis AIP1-2 restricted by WER-mediated patterning modulates planar polarity. Development, 2015. 142(5): p. 1022 [PMID:25715402] Kwak SH,Song SK,Lee MM,Schiefelbein J TORNADO1 regulates root epidermal patterning through the WEREWOLF pathway in Arabidopsis thaliana. Plant Signal Behav, 2015. 10(12): p. e1103407 [PMID:26451798] Zhu Y, et al. The Histone Chaperone NRP1 Interacts with WEREWOLF to Activate GLABRA2 in Arabidopsis Root Hair Development. Plant Cell, 2017. 29(2): p. 260-276 [PMID:28138017] Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana. Plant J., 2017. 92(2): p. 305-316 [PMID:28771873] Mira MM, et al. Expression of Arabidopsis class 1 phytoglobin (AtPgb1) delays death and degradation of the root apical meristem during severe PEG-induced water deficit. J. Exp. Bot., 2017. 68(20): p. 5653-5668 [PMID:29059380] Kohanová J, et al. Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots. Ann. Bot., 2018. 122(5): p. 903-914 [PMID:29394308]