PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pbr025657.1

Organism

Pyrus bretschneideri

Taxonomic ID

225117

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus

Family

M-type_MADS

Protein Properties

Length: 238aa MW: 26295.2 Da PI: 9.5105

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pbr025657.1	genome	CPETR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	65.8	4.3e-21	21	62	4	45
-SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS SRF-TF 4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 n qvtfskRr g++KKA+EL++LC++e+a+i+fs+ +k Pbr025657.1 21 PKRNNLQVTFSKRRSGLFKKASELCTLCGVEIAIIVFSPANK 62 566789*********************************998 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	22.806	10	70	IPR002100	Transcription factor, MADS-box
SMART	SM00432	8.7E-30	10	69	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.10E-32	11	79	No hit	No description
SuperFamily	SSF55455	3.27E-26	11	85	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.5E-17	12	32	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.3E-24	19	66	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.5E-17	32	47	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.5E-17	47	68	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 238 aa Download sequence Send to blast
MVMKIKKPSQ GRQKIAIAKI PKRNNLQVTF SKRRSGLFKK ASELCTLCGV EIAIIVFSPA 60 NKPFSFGHPE VDSIVDRFLA RNPYPNFQAG STGSTQQLVE VHRNASVHEL NMQLTQVVNQ 120 LEAEKKCGEA LDKISKASEK QCWWERPVEE LGFHELQILK ASLEELKKNM TKQANGILME 180 SSAAAVANCS SSSSPFFMMN INGVVQGDDL RCFESKIKPT NQHGSAYSFG YAGHGLF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	2e-15	11	78	2	69	Myocyte-specific enhancer factor 2B
1tqe_Q	2e-15	11	78	2	69	Myocyte-specific enhancer factor 2B
1tqe_R	2e-15	11	78	2	69	Myocyte-specific enhancer factor 2B
1tqe_S	2e-15	11	78	2	69	Myocyte-specific enhancer factor 2B
3kov_A	2e-15	11	82	1	72	Myocyte-specific enhancer factor 2A
3kov_B	2e-15	11	82	1	72	Myocyte-specific enhancer factor 2A
3kov_I	2e-15	11	82	1	72	Myocyte-specific enhancer factor 2A
3kov_J	2e-15	11	82	1	72	Myocyte-specific enhancer factor 2A
3p57_A	2e-15	11	82	1	72	Myocyte-specific enhancer factor 2A
3p57_B	2e-15	11	82	1	72	Myocyte-specific enhancer factor 2A
3p57_C	2e-15	11	82	1	72	Myocyte-specific enhancer factor 2A
3p57_D	2e-15	11	82	1	72	Myocyte-specific enhancer factor 2A
3p57_I	2e-15	11	82	1	72	Myocyte-specific enhancer factor 2A
3p57_J	2e-15	11	82	1	72	Myocyte-specific enhancer factor 2A
6c9l_A	2e-15	11	78	2	69	Myocyte-specific enhancer factor 2B
6c9l_B	2e-15	11	78	2	69	Myocyte-specific enhancer factor 2B
6c9l_C	2e-15	11	78	2	69	Myocyte-specific enhancer factor 2B
6c9l_D	2e-15	11	78	2	69	Myocyte-specific enhancer factor 2B
6c9l_E	2e-15	11	78	2	69	Myocyte-specific enhancer factor 2B
6c9l_F	2e-15	11	78	2	69	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269\|PubMed:18334668}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Pbr025657.1

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_028964768.1	1e-174	agamous-like MADS-box protein AGL62
Swissprot	Q9FKK2	1e-56	AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBL	A0A498IWI1	1e-164	A0A498IWI1_MALDO; Uncharacterized protein
STRING	XP_009335378.1	1e-149	(Pyrus x bretschneideri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF128	33	331

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60440.1	7e-58	AGAMOUS-like 62

Publications ? help Back to Top
Xu W, et al. Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds. Plant Cell, 2016. 28(6): p. 1343-60 [PMID:27233529] Figueiredo DD,Batista RA,Roszak PJ,Köhler C Auxin production couples endosperm development to fertilization. Nat Plants, 2015. 1: p. 15184 [PMID:27251719] Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C Auxin production in the endosperm drives seed coat development in Arabidopsis. Elife, 2017. [PMID:27848912] Fiume E,Coen O,Xu W,Lepiniec L,Magnani E Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal. Plant Signal Behav, 2017. 12(8): p. e1339000 [PMID:28613109] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]