PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr036818.1
Organism
Pyrus bretschneideri
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 146aa    MW: 16576.2 Da    PI: 11.5527
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr036818.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.4e-161763147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg+WT+ Ed ll+++++ +G g+W++ ++  g+ R++k+ck+rw + 
      Pbr036818.1 17 RGSWTAREDNLLIQYINSHGEGRWSSLPENAGLLRCGKSCKLRWMNN 63
                     89******************************99**********997 PP
2Myb_DNA-binding46.11.2e-1474114548
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      T++ +el+++++++lG++ W++Ia +++ gRt++++k++w+++l
      Pbr036818.1  74 TPD-EELILRLHALLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 114
                      555.577889********.*********.************996 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.3031264IPR017930Myb domain
SuperFamilySSF466891.21E-2614110IPR009057Homeodomain-like
SMARTSM007177.3E-131666IPR001005SANT/Myb domain
PfamPF002492.0E-141764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-211870IPR009057Homeodomain-like
CDDcd001671.68E-101964No hitNo description
PROSITE profilePS5129421.47965118IPR017930Myb domain
SMARTSM007176.0E-1269116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2271117IPR009057Homeodomain-like
PfamPF002494.9E-1374114IPR001005SANT/Myb domain
CDDcd001674.07E-1074114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MLNMGRAPCC SKVGLHRGSW TAREDNLLIQ YINSHGEGRW SSLPENAGLL RCGKSCKLRW  60
MNNLRPGIKR GNITPDEELI LRLHALLGNR WSLIAGRLPG RTDNEIKNYW NTHLSRRFKN  120
PTTGKGTEKQ SSTRKRASKP QKRML*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-241511825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtFlavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis mainly in the root (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269|PubMed:15923334, ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:20731781}.
UniProtTranscription factor involved in the negative regulation of flavonol biosynthesis. Represses the early phenylpropanoid genes, phenylalanine ammonia-lyase (PAL), cinnamate 4-hydroxylase (C4H) and 4-coumarate-CoA ligase (4CL), as well as the flavonoid-specific genes, flavonoid 3'-hydroxylase (F3'H) and dihydroflavonol 4-reductase (DFR) (PubMed:24319076). Plays a role in seed germination inhibition. Negatively regulates the expression of the abscisic acid (ABA) signaling transcription factor ABI5 in seeds (PubMed:25053018). {ECO:0000269|PubMed:24319076, ECO:0000269|PubMed:25053018}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr036818.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By nitrogen deficiency, sucrose and UV LIGHT (PubMed:17053893, PubMed:9839469). Triggered by HY5 in response to light and UV-B (PubMed:19895401). {ECO:0000269|PubMed:17053893, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:9839469}.
UniProtINDUCTION: Induced by abscisic acid (ABA) and osmotic stress (PubMed:25053018). Induced by salt stress (PubMed:24319076, PubMed:25053018). {ECO:0000269|PubMed:24319076, ECO:0000269|PubMed:25053018}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018500216.11e-100PREDICTED: transcription repressor MYB6-like
SwissprotO222643e-56MYB12_ARATH; Transcription factor MYB12
SwissprotQ423792e-56MYB7_ARATH; Transcription factor MYB7
TrEMBLA0A251P7N11e-68A0A251P7N1_PRUPE; Uncharacterized protein
TrEMBLM5WPN05e-69M5WPN0_PRUPE; Uncharacterized protein
STRINGXP_009359589.12e-96(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.11e-58myb domain protein 7
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pandey A, et al.
    Co-expression of Arabidopsis transcription factor, AtMYB12, and soybean isoflavone synthase, GmIFS1, genes in tobacco leads to enhanced biosynthesis of isoflavones and flavonols resulting in osteoprotective activity.
    Plant Biotechnol. J., 2014. 12(1): p. 69-80
    [PMID:24102754]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Schenke D,Cai D,Scheel D
    Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification.
    Plant Cell Environ., 2014. 37(7): p. 1716-21
    [PMID:24450952]
  5. Pandey A, et al.
    AtMYB12 expression in tomato leads to large scale differential modulation in transcriptome and flavonoid content in leaf and fruit tissues.
    Sci Rep, 2015. 5: p. 12412
    [PMID:26206248]
  6. Zhou M, et al.
    Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis.
    Plant J., 2015. 84(2): p. 395-403
    [PMID:26332741]
  7. Lotkowska ME, et al.
    The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress.
    Plant Physiol., 2015. 169(3): p. 1862-80
    [PMID:26378103]
  8. Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN
    The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors.
    Plant Physiol. Biochem., 2016. 102: p. 70-9
    [PMID:26913794]
  9. Li Y, et al.
    Development of Marker-Free Transgenic Potato Tubers Enriched in Caffeoylquinic Acids and Flavonols.
    J. Agric. Food Chem., 2016. 64(14): p. 2932-40
    [PMID:27019017]
  10. Zhou Z,Schenke D,Miao Y,Cai D
    Investigation of the crosstalk between the flg22 and the UV-B-induced flavonol pathway in Arabidopsis thaliana seedlings.
    Plant Cell Environ., 2017. 40(3): p. 453-458
    [PMID:28032363]
  11. Wang N, et al.
    MYB12 and MYB22 play essential roles in proanthocyanidin and flavonol synthesis in red-fleshed apple (Malus sieversii f. niedzwetzkyana).
    Plant J., 2017. 90(2): p. 276-292
    [PMID:28107780]
  12. Stracke R,Turgut-Kara N,Weisshaar B
    The AtMYB12 activation domain maps to a short C-terminal region of the transcription factor.
    Z. Naturforsch., C, J. Biosci., 2017. 72(7-8): p. 251-257
    [PMID:28284041]
  13. Zhou M, et al.
    LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis.
    Plant Physiol., 2017. 174(3): p. 1348-1358
    [PMID:28483877]
  14. Mondal SK,Roy S
    Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis.
    J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601
    [PMID:28490275]
  15. Hidalgo D, et al.
    Tailoring tobacco hairy root metabolism for the production of stilbenes.
    Sci Rep, 2017. 7(1): p. 17976
    [PMID:29269790]