PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pbr037155.1

Organism

Pyrus bretschneideri

Taxonomic ID

225117

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus

Family

MYB_related

Protein Properties

Length: 65aa MW: 7230.43 Da PI: 10.4789

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pbr037155.1	genome	CPETR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53.5	5.3e-17	17	64	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+ Ed ll+++++ +G g+W++ ++ g+ R++k+ck+rw + l Pbr037155.1 17 RGSWTAREDNLLIQYINSHGEGRWSSLPKNAGLLRCGKSCKLRWMNNL 64 89****************************99********9975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	3.7E-19	8	64	IPR009057	Homeodomain-like
SuperFamily	SSF46689	6.68E-14	11	63	IPR009057	Homeodomain-like
PROSITE profile	PS51294	19.368	12	64	IPR017930	Myb domain
SMART	SM00717	1.2E-7	16	64	IPR001005	SANT/Myb domain
Pfam	PF00249	1.9E-15	17	64	IPR001005	SANT/Myb domain
CDD	cd00167	1.70E-11	19	64	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 65 aa Download sequence Send to blast
MLNMGRAPCC SKVGLHRGSW TAREDNLLIQ YINSHGEGRW SSLPKNAGLL RCGKSCKLRW 60 MNNL*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor postulated to regulate the biosynthetic pathway of a flavonoid-derived pigment in certain floral tissues.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Pbr037155.1

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018500216.1	8e-38	PREDICTED: transcription repressor MYB6-like
Swissprot	P27898	3e-26	MYBP_MAIZE; Myb-related protein P
TrEMBL	A0A251P7N1	1e-30	A0A251P7N1_PRUPE; Uncharacterized protein
TrEMBL	M5WPN0	5e-31	M5WPN0_PRUPE; Uncharacterized protein
STRING	XP_009359589.1	1e-37	(Pyrus x bretschneideri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G49330.1	5e-28	myb domain protein 111

Publications ? help Back to Top
Robbins ML,Sekhon RS,Meeley R,Chopra S A Mutator transposon insertion is associated with ectopic expression of a tandemly repeated multicopy Myb gene pericarp color1 of maize. Genetics, 2008. 178(4): p. 1859-74 [PMID:18430921] Sidorenko L,Chandler V RNA-dependent RNA polymerase is required for enhancer-mediated transcriptional silencing associated with paramutation at the maize p1 gene. Genetics, 2008. 180(4): p. 1983-93 [PMID:18845841] Robbins ML,Wang P,Sekhon RS,Chopra S Gene structure induced epigenetic modifications of pericarp color1 alleles of maize result in tissue-specific mosaicism. PLoS ONE, 2009. 4(12): p. e8231 [PMID:20011605] Rhee Y,Sekhon RS,Chopra S,Kaeppler S Tissue culture-induced novel epialleles of a Myb transcription factor encoded by pericarp color1 in maize. Genetics, 2010. 186(3): p. 843-55 [PMID:20823340] Morohashi K, et al. A genome-wide regulatory framework identifies maize pericarp color1 controlled genes. Plant Cell, 2012. 24(7): p. 2745-64 [PMID:22822204]