PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pbr037208.1

Organism

Pyrus bretschneideri

Taxonomic ID

225117

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus

Family

MYB_related

Protein Properties

Length: 95aa MW: 10578.5 Da PI: 11.0416

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pbr037208.1	genome	CPETR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	35.4	2.4e-11	40	76	11	48
HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +l+++vkq+G g W+ I +++ gR +kqc++rw+++l Pbr037208.1 40 KLIRLVKQYGVGKWAQIVEKLV-GRAGKQCRERWHNHL 76 79******************.***********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00717	1.8E-4	29	78	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	14.283	33	80	IPR017930	Myb domain
CDD	cd00167	1.60E-10	40	76	No hit	No description
SuperFamily	SSF46689	4.71E-12	40	81	IPR009057	Homeodomain-like
Pfam	PF13921	7.5E-10	40	81	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.5E-16	40	82	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 95 aa Download sequence Send to blast
MLTLPSNNHH QRARSLEGML PLPPPSSSAR SPKTALIAGK LIRLVKQYGV GKWAQIVEKL 60 VGRAGKQCRE RWHNHLHPHI KAICSYISLG CYKF*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for female gametophyte fertility. Acts redundantly with MYB64 to initiate the FG5 transition during female gametophyte development. The FG5 transition represents the switch between free nuclear divisions and cellularization-differentiation in female gametophyte, and occurs during developmental stage FG5. {ECO:0000269\|PubMed:24068955}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Pbr037208.1

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012454624.1	1e-20	PREDICTED: transcription factor MYB44-like isoform X2
Swissprot	Q9FIM4	9e-16	MY119_ARATH; Transcription factor MYB119
TrEMBL	A0A0D2T6S5	1e-19	A0A0D2T6S5_GOSRA; Uncharacterized protein
TrEMBL	A0A2P5WRS1	2e-19	A0A2P5WRS1_GOSBA; Uncharacterized protein
STRING	Gorai.011G044100.1	1e-19	(Gossypium raimondii)
STRING	Gorai.011G120200.1	2e-20	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF4129	31	58

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G58850.1	1e-18	myb domain protein 119

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]