![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pbr040479.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 158aa MW: 17900 Da PI: 5.2667 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 39.4 | 1.3e-12 | 30 | 88 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
++ +r+ +NRe+ArrsR RK++ + L+ + L+ N + + ++ ++++ kl++e+
Pbr040479.1 30 RKRKRMLSNRESARRSRMRKQEHMTDLTAQIGLLTRDNNQIITSMNVTNQLYMKLEAEN 88
67899************************************************999987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.20.5.170 | 4.7E-11 | 24 | 109 | No hit | No description |
| SMART | SM00338 | 2.5E-14 | 26 | 90 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 9.841 | 28 | 91 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 8.04E-12 | 30 | 83 | No hit | No description |
| Pfam | PF00170 | 4.0E-10 | 30 | 88 | IPR004827 | Basic-leucine zipper domain |
| CDD | cd14702 | 8.28E-15 | 31 | 82 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 33 | 48 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009845 | Biological Process | seed germination | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 158 aa Download sequence Send to blast |
MASSSGVSSE SSKLQNSGSD EDLNQVMDQR KRKRMLSNRE SARRSRMRKQ EHMTDLTAQI 60 GLLTRDNNQI ITSMNVTNQL YMKLEAENSV LRAQMDELRN RLQSLNDIMD CINSSKWIYE 120 EEDNHNNIGG GDGFLNPWSA GFLNNQPIMA SADMFMC* |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 42 | 49 | RRSRMRKQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269|PubMed:23461773}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00239 | DAP | Transfer from AT1G75390 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Pbr040479.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009346044.1 | 1e-113 | PREDICTED: bZIP transcription factor 11-like isoform X1 | ||||
| Refseq | XP_009346045.2 | 1e-113 | PREDICTED: bZIP transcription factor 11-like isoform X2 | ||||
| Refseq | XP_018500633.1 | 1e-113 | PREDICTED: bZIP transcription factor 11-like isoform X1 | ||||
| Swissprot | C0Z2L5 | 4e-45 | BZP44_ARATH; bZIP transcription factor 44 | ||||
| TrEMBL | D9ZIQ2 | 2e-99 | D9ZIQ2_MALDO; BZIP domain class transcription factor | ||||
| STRING | XP_009346044.1 | 1e-112 | (Pyrus x bretschneideri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF613 | 34 | 147 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G75390.1 | 8e-47 | basic leucine-zipper 44 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




