PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pbr041076.1

Organism

Pyrus bretschneideri

Taxonomic ID

225117

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus

Family

NAC

Protein Properties

Length: 185aa MW: 21278.6 Da PI: 8.9495

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pbr041076.1	genome	CPETR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	165.4	2e-51	25	151	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 pGfrFhPtdeelv++yL++k+++k+++l e ik++diyk++PwdLpk+ a++kewyfF+kr +ky+++ r+nr+t sg+Wkatg dk+++s++ge Pbr041076.1 25 LPGFRFHPTDEELVDFYLRRKIQKKPISL-ELIKSIDIYKHDPWDLPKT--AGDKEWYFFCKRGRKYKNSIRPNRVTGSGFWKATGIDKPIHSHGGES 119 59*************************.99***********44..589***********************************95544 PP NAM 100 ...vglkktLvfykgrapkgektdWvmheyrl 128 glkktLv+y+g+a kg+ktdW+mhe+rl Pbr041076.1 120 hacSGLKKTLVYYRGSAGKGSKTDWMMHEFRL 151 4559************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	6.15E-53	24	159	IPR003441	NAC domain
PROSITE profile	PS51005	48.944	24	184	IPR003441	NAC domain
Pfam	PF02365	1.2E-26	26	151	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 185 aa Download sequence Send to blast
MDNTYYSPSN KDDHQYTDDE DDVQLPGFRF HPTDEELVDF YLRRKIQKKP ISLELIKSID 60 IYKHDPWDLP KTAGDKEWYF FCKRGRKYKN SIRPNRVTGS GFWKATGIDK PIHSHGGESH 120 ACSGLKKTLV YYRGSAGKGS KTDWMMHEFR LPNSSSSNEH NNRSSNPKNM NTDPQQEAVS 180 EKSA*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-46	15	158	7	149	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-46	15	158	7	149	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-46	15	158	7	149	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-46	15	158	7	149	NO APICAL MERISTEM PROTEIN
3swm_A	2e-46	15	158	10	152	NAC domain-containing protein 19
3swm_B	2e-46	15	158	10	152	NAC domain-containing protein 19
3swm_C	2e-46	15	158	10	152	NAC domain-containing protein 19
3swm_D	2e-46	15	158	10	152	NAC domain-containing protein 19
3swp_A	2e-46	15	158	10	152	NAC domain-containing protein 19
3swp_B	2e-46	15	158	10	152	NAC domain-containing protein 19
3swp_C	2e-46	15	158	10	152	NAC domain-containing protein 19
3swp_D	2e-46	15	158	10	152	NAC domain-containing protein 19
4dul_A	2e-46	15	158	7	149	NAC domain-containing protein 19
4dul_B	2e-46	15	158	7	149	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269\|PubMed:22345491}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Pbr041076.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269\|PubMed:22345491}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009361809.1	1e-132	PREDICTED: transcription factor JUNGBRUNNEN 1-like
Swissprot	Q9SK55	4e-71	NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBL	A0A498IWU5	1e-120	A0A498IWU5_MALDO; Uncharacterized protein
STRING	XP_009361809.1	1e-131	(Pyrus x bretschneideri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1013	34	112

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G43000.1	4e-72	NAC domain containing protein 42

Publications ? help Back to Top
Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins. Plant Signal Behav, 2016. 11(6): p. e1181245 [PMID:27159137] Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling. Nat Plants, 2016. 2: p. 16013 [PMID:27249348] Shahnejat-Bushehri S, et al. Arabidopsis NAC Transcription Factor JUNGBRUNNEN1 Exerts Conserved Control Over Gibberellin and Brassinosteroid Metabolism and Signaling Genes in Tomato. Front Plant Sci, 2017. 8: p. 214 [PMID:28326087] Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways. Plant J., 2017. 92(6): p. 1106-1120 [PMID:29032592] Ebrahimian-Motlagh S, et al. JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13. Front Plant Sci, 2017. 8: p. 2118 [PMID:29326734]