![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pbr042477.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 72aa MW: 8286.49 Da PI: 6.5222 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 61.2 | 3.3e-19 | 9 | 56 | 1 | 49 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
+ppGfrFhPtdeel+++yLkkkv+ +k+++ evi+evd++++ePw+L++
Pbr042477.1 9 VPPGFRFHPTDEELLHYYLKKKVSFQKFDM-EVIREVDLNQMEPWELQA 56
69****************************.99**************83 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 3.53E-18 | 7 | 58 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 19.182 | 9 | 71 | IPR003441 | NAC domain |
| Pfam | PF02365 | 5.2E-9 | 10 | 52 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 72 aa Download sequence Send to blast |
MANSSSGGVP PGFRFHPTDE ELLHYYLKKK VSFQKFDMEV IREVDLNQME PWELQALQSF 60 LINNKLETGK K* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Pbr042477.1 |
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC210382 | 6e-44 | AC210382.1 Populus trichocarpa clone POP018-P22, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009347397.1 | 2e-32 | PREDICTED: protein BEARSKIN2-like | ||||
| Swissprot | Q9SV87 | 6e-29 | BRN2_ARATH; Protein BEARSKIN2 | ||||
| TrEMBL | A0A314ZLB8 | 1e-33 | A0A314ZLB8_PRUYE; Protein BEARSKIN2 | ||||
| STRING | XP_009347397.1 | 6e-32 | (Pyrus x bretschneideri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF11433 | 17 | 39 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G10350.1 | 2e-31 | NAC domain containing protein 70 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




