PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Peaxi162Scf00016g03251.1

Organism

Petunia axillaris

Taxonomic ID

33119

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia

Family

M-type_MADS

Protein Properties

Length: 228aa MW: 25808.1 Da PI: 10.2299

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Peaxi162Scf00016g03251.1	genome	SGN	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	63.7	2e-20	17	63	3	49
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 + +sn vtfskRr g++KKA+EL++LC++e+a+++fs+ k++ + Peaxi162Scf00016g03251.1 17 MSKESNLLVTFSKRRSGLFKKASELCTLCGVEIAIVVFSPGRKVFSF 63 67789999********************************9999877 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	2.7E-28	7	66	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	22.708	7	67	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.35E-31	8	76	No hit	No description
SuperFamily	SSF55455	1.7E-25	8	78	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.9E-17	9	29	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.7E-22	17	63	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.9E-17	29	44	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.9E-17	44	65	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009960	Biological Process	endosperm development
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 228 aa Download sequence Send to blast
MARKMSKGRQ KIQMKKMSKE SNLLVTFSKR RSGLFKKASE LCTLCGVEIA IVVFSPGRKV 60 FSFGHPNVES IIDRFLMTRN NIPSATSSTT SQLVEAHRNA NVRELNVQLM EIINQLEFEK 120 KREVEIEKIR KAANIGKNWW EGPVNELGLG ELEQLKLGME ELKKNVTKQM QKFILEASSS 180 PAGLFLGGSF FNGGQVDDTR MAWRSLCEII ATKEAHCIYM IWLTSGTF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3kov_A	7e-15	8	96	1	86	Myocyte-specific enhancer factor 2A
3kov_B	7e-15	8	96	1	86	Myocyte-specific enhancer factor 2A
3kov_I	7e-15	8	96	1	86	Myocyte-specific enhancer factor 2A
3kov_J	7e-15	8	96	1	86	Myocyte-specific enhancer factor 2A
3p57_A	7e-15	8	96	1	86	Myocyte-specific enhancer factor 2A
3p57_B	7e-15	8	96	1	86	Myocyte-specific enhancer factor 2A
3p57_C	7e-15	8	96	1	86	Myocyte-specific enhancer factor 2A
3p57_D	7e-15	8	96	1	86	Myocyte-specific enhancer factor 2A
3p57_I	7e-15	8	96	1	86	Myocyte-specific enhancer factor 2A
3p57_J	7e-15	8	96	1	86	Myocyte-specific enhancer factor 2A
5f28_A	1e-14	8	96	2	87	MEF2C
5f28_B	1e-14	8	96	2	87	MEF2C
5f28_C	1e-14	8	96	2	87	MEF2C
5f28_D	1e-14	8	96	2	87	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269\|PubMed:18334668}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016581988.1	1e-110	PREDICTED: agamous-like MADS-box protein AGL62
Refseq	XP_016581993.1	1e-110	PREDICTED: agamous-like MADS-box protein AGL62
Swissprot	Q9FKK2	5e-62	AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBL	A0A1U8HL60	1e-109	A0A1U8HL60_CAPAN; agamous-like MADS-box protein AGL62
TrEMBL	A0A1U8HL64	1e-109	A0A1U8HL64_CAPAN; Agamous-like MADS-box protein AGL62
STRING	Solyc01g106720.1.1	1e-106	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA204	24	223

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60440.1	3e-49	AGAMOUS-like 62

Publications ? help Back to Top
Xu W, et al. Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds. Plant Cell, 2016. 28(6): p. 1343-60 [PMID:27233529] Figueiredo DD,Batista RA,Roszak PJ,Köhler C Auxin production couples endosperm development to fertilization. Nat Plants, 2015. 1: p. 15184 [PMID:27251719] Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C Auxin production in the endosperm drives seed coat development in Arabidopsis. Elife, 2017. [PMID:27848912] Fiume E,Coen O,Xu W,Lepiniec L,Magnani E Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal. Plant Signal Behav, 2017. 12(8): p. e1339000 [PMID:28613109] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]