![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Peaxi162Scf00023g00289.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 73aa MW: 8552.1 Da PI: 11.5281 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 90.6 | 7.8e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
kri+nk rqvtfskRr+g++KKA+ELS+LCd++vav++fs++g+ly++ss
Peaxi162Scf00023g00289.1 9 KRIQNKNSRQVTFSKRRKGLIKKAKELSILCDVDVAVVVFSNRGRLYDFSS 59
79***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF55455 | 3.14E-29 | 1 | 66 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.2E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 30.74 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 5.59E-33 | 2 | 60 | No hit | No description |
| PRINTS | PR00404 | 4.2E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 5.2E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.2E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.2E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 73 aa Download sequence Send to blast |
MGRKKVEIKR IQNKNSRQVT FSKRRKGLIK KAKELSILCD VDVAVVVFSN RGRLYDFSST 60 NRTEHLFKKP LPF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 1e-19 | 1 | 68 | 1 | 68 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 1e-19 | 1 | 68 | 1 | 68 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 1e-19 | 1 | 68 | 1 | 68 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 1e-19 | 1 | 68 | 1 | 68 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 1e-19 | 1 | 68 | 1 | 68 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 1e-19 | 1 | 68 | 1 | 68 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 1e-19 | 1 | 68 | 1 | 68 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 1e-19 | 1 | 68 | 1 | 68 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 1e-19 | 1 | 68 | 1 | 68 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 1e-19 | 1 | 68 | 1 | 68 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY370529 | 1e-79 | AY370529.1 Petunia x hybrida MADS-box protein 15 (PMADS15) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009795052.1 | 3e-33 | PREDICTED: agamous-like MADS-box protein AGL27 isoform X1 | ||||
| Refseq | XP_009795053.1 | 3e-33 | PREDICTED: agamous-like MADS-box protein AGL27 isoform X2 | ||||
| Refseq | XP_009804704.1 | 2e-33 | PREDICTED: agamous-like MADS-box protein AGL27 | ||||
| Refseq | XP_016435771.1 | 3e-33 | PREDICTED: agamous-like MADS-box protein AGL27 isoform X1 | ||||
| Refseq | XP_016435773.1 | 3e-33 | PREDICTED: agamous-like MADS-box protein AGL27 isoform X2 | ||||
| Refseq | XP_019260170.1 | 1e-33 | PREDICTED: agamous-like MADS-box protein AGL27 | ||||
| Swissprot | Q39295 | 2e-25 | AGL15_BRANA; Agamous-like MADS-box protein AGL15 | ||||
| TrEMBL | A0A1S3X7B1 | 7e-32 | A0A1S3X7B1_TOBAC; agamous-like MADS-box protein AGL27 isoform X1 | ||||
| TrEMBL | A0A1S3X7P8 | 6e-32 | A0A1S3X7P8_TOBAC; agamous-like MADS-box protein AGL27 isoform X2 | ||||
| TrEMBL | A0A1U7XSL9 | 7e-32 | A0A1U7XSL9_NICSY; agamous-like MADS-box protein AGL27 isoform X1 | ||||
| TrEMBL | A0A1U7XVV4 | 6e-32 | A0A1U7XVV4_NICSY; agamous-like MADS-box protein AGL27 isoform X2 | ||||
| TrEMBL | A0A1U7Z004 | 4e-32 | A0A1U7Z004_NICSY; agamous-like MADS-box protein AGL27 | ||||
| TrEMBL | A0A314LCH5 | 9e-33 | A0A314LCH5_NICAT; Mads-box transcription factor 57 | ||||
| STRING | XP_009795052.1 | 1e-32 | (Nicotiana sylvestris) | ||||
| STRING | XP_009804704.1 | 7e-33 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA40 | 24 | 625 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13790.1 | 9e-28 | AGAMOUS-like 15 | ||||




