![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Peaxi162Scf00037g00085.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 140aa MW: 15902.7 Da PI: 4.5591 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 149.7 | 5.9e-47 | 6 | 99 | 4 | 97 |
NF-YB 4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90
++++P+anv+rimk++lP akisk+aket+qec+sefisfvt+easdkc++e+r+t+ngdd++wal++lGf+ y+e++ yl k
Peaxi162Scf00037g00085.1 6 VNKLVPVANVGRIMKQILPPTAKISKEAKETMQECASEFISFVTGEASDKCHKENRRTVNGDDICWALSSLGFDSYAEAMIRYLYKL 92
5899*********************************************************************************** PP
NF-YB 91 relegek 97
re+e+++
Peaxi162Scf00037g00085.1 93 REFERQR 99
****986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 3.42E-36 | 9 | 122 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 3.6E-45 | 9 | 125 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.1E-25 | 10 | 73 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.2E-16 | 37 | 55 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 40 | 56 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.2E-16 | 56 | 74 | No hit | No description |
| PRINTS | PR00615 | 2.2E-16 | 75 | 93 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 140 aa Download sequence Send to blast |
MVDEHVNKLV PVANVGRIMK QILPPTAKIS KEAKETMQEC ASEFISFVTG EASDKCHKEN 60 RRTVNGDDIC WALSSLGFDS YAEAMIRYLY KLREFERQRA NQSKGSFNDD EDTDDEATSE 120 SEKQETTLSP PAPLEYFNLK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 2e-36 | 7 | 94 | 5 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 2e-36 | 7 | 94 | 5 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00133 | DAP | Transfer from AT1G09030 | Download |
| |||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019233101.1 | 6e-79 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
| Swissprot | O04027 | 8e-51 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | A0A2G2W7T3 | 1e-78 | A0A2G2W7T3_CAPBA; Nuclear transcription factor Y subunit B-4 | ||||
| STRING | XP_009760265.1 | 5e-76 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA111 | 24 | 356 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09030.1 | 2e-52 | nuclear factor Y, subunit B4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




