![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Peaxi162Scf00055g02415.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 174aa MW: 20495 Da PI: 10.2214 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 150.3 | 9.6e-47 | 11 | 140 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.....kvkaeekewyfFskrdkkyatgkrknratksg 81
ppG+rFhPt eel+++yL++++ +++ + ++i+++d+yk+ Pw+Lp k++ e+k+wyfFs rd+ky++g r+ ra+ sg
Peaxi162Scf00055g02415.1 11 PPGIRFHPTGEELIMYYLRNQTILRPCLV-SIIPDIDVYKFTPWELPVsildkKAEFEKKKWYFFSLRDRKYPNGIRPIRAAVSG 94
9*************************988.89***************5467765556889************************* PP
NAM 82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
yWkatg+dk+++s +++ v +kk Lvfykgr pkg ktdW+mheyrl
Peaxi162Scf00055g02415.1 95 YWKATGTDKAIHS-GSKYVDIKKALVFYKGRPPKGIKTDWIMHEYRL 140
*************.999****************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 2.75E-51 | 8 | 146 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 48.728 | 10 | 168 | IPR003441 | NAC domain |
| Pfam | PF02365 | 8.6E-22 | 11 | 140 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 174 aa Download sequence Send to blast |
MIKKNSSEKF PPGIRFHPTG EELIMYYLRN QTILRPCLVS IIPDIDVYKF TPWELPVSIL 60 DKKAEFEKKK WYFFSLRDRK YPNGIRPIRA AVSGYWKATG TDKAIHSGSK YVDIKKALVF 120 YKGRPPKGIK TDWIMHEYRL SESKSQSIRT NGSMKIMAPY FMFNVYYMFE LGHC |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 6e-49 | 10 | 156 | 17 | 154 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 6e-49 | 10 | 156 | 17 | 154 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 6e-49 | 10 | 156 | 17 | 154 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 6e-49 | 10 | 156 | 17 | 154 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 6e-49 | 10 | 156 | 20 | 157 | NAC domain-containing protein 19 |
| 3swm_B | 6e-49 | 10 | 156 | 20 | 157 | NAC domain-containing protein 19 |
| 3swm_C | 6e-49 | 10 | 156 | 20 | 157 | NAC domain-containing protein 19 |
| 3swm_D | 6e-49 | 10 | 156 | 20 | 157 | NAC domain-containing protein 19 |
| 3swp_A | 6e-49 | 10 | 156 | 20 | 157 | NAC domain-containing protein 19 |
| 3swp_B | 6e-49 | 10 | 156 | 20 | 157 | NAC domain-containing protein 19 |
| 3swp_C | 6e-49 | 10 | 156 | 20 | 157 | NAC domain-containing protein 19 |
| 3swp_D | 6e-49 | 10 | 156 | 20 | 157 | NAC domain-containing protein 19 |
| 4dul_A | 6e-49 | 10 | 156 | 17 | 154 | NAC domain-containing protein 19 |
| 4dul_B | 6e-49 | 10 | 156 | 17 | 154 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009781251.1 | 1e-84 | PREDICTED: NAC transcription factor 29-like | ||||
| Refseq | XP_016451619.1 | 1e-84 | PREDICTED: NAC transcription factor 29-like | ||||
| Swissprot | K4BNG7 | 6e-81 | NAP2_SOLLC; NAC domain-containing protein 2 | ||||
| TrEMBL | A0A1S3YHB4 | 3e-83 | A0A1S3YHB4_TOBAC; NAC transcription factor 29-like | ||||
| TrEMBL | A0A1U7WVA7 | 3e-83 | A0A1U7WVA7_NICSY; NAC transcription factor 29-like | ||||
| STRING | XP_009781251.1 | 4e-84 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA746 | 24 | 103 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G69490.1 | 3e-78 | NAC-like, activated by AP3/PI | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




