PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Peaxi162Scf00122g02012.1

Organism

Petunia axillaris

Taxonomic ID

33119

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia

Family

M-type_MADS

Protein Properties

Length: 97aa MW: 10955 Da PI: 9.9475

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Peaxi162Scf00122g02012.1	genome	SGN	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	52.5	6.5e-17	12	53	4	45
-SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS SRF-TF 4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 ++ + qvtfsk +ng+lKKA+ELS Cd ev +iifs++ Peaxi162Scf00122g02012.1 12 KSAISSQVTFSKQLNGLLKKAFELSLQCDCEVGLIIFSPRSS 53 677889********************************9876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	6.2E-14	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	19.161	1	54	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.96E-16	3	54	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.1E-15	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	5.9E-15	16	52	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.1E-15	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.1E-15	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 97 aa Download sequence Send to blast
MVRGKAQIRH TKSAISSQVT FSKQLNGLLK KAFELSLQCD CEVGLIIFSP RSSVNFLLKA 60 TKFVHYYGYV ISVGVDFVFL ISSVFLVIDF RLLSEFI

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that promotes flowering, especially in response to vernalization by short periods of cold, in an FLC-inpedendent manner. {ECO:0000269\|PubMed:16778081}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Maintained at very low levels by the polycomb-group (PcG) proteins MSI1, CLF, and EMF2 via histone methylation (H3K27me3). Derepressed upon cold treatment (vernalization). {ECO:0000269\|PubMed:16778081}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012492162.1	3e-19	PREDICTED: MADS-box protein SOC1-like
Swissprot	O82743	1e-17	AGL19_ARATH; Agamous-like MADS-box protein AGL19
TrEMBL	A0A287FK27	9e-19	A0A287FK27_HORVV; Uncharacterized protein
STRING	Gorai.007G237300.1	1e-18	(Gossypium raimondii)
STRING	XP_010106753.1	6e-19	(Morus notabilis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G22950.1	4e-20	AGAMOUS-like 19

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Suter L,Rüegg M,Zemp N,Hennig L,Widmer A Gene regulatory variation mediates flowering responses to vernalization along an altitudinal gradient in Arabidopsis. Plant Physiol., 2014. 166(4): p. 1928-42 [PMID:25339407]