PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Peaxi162Scf00184g00018.1

Organism

Petunia axillaris

Taxonomic ID

33119

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia

Family

NAC

Protein Properties

Length: 195aa MW: 22946.5 Da PI: 10.0667

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Peaxi162Scf00184g00018.1	genome	SGN	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	151.5	4e-47	10	132	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 lpp frFhPtdeel+++yL+++++ +++++ i +vd+yk++Pw+Lp+++ ++k+ yfFs rd+kya+g r+nra+ s+yWka Peaxi162Scf00184g00018.1 10 LPPEFRFHPTDEELIMYYLCNQATLRPCPV--SIVSVDVYKFDPWELPAEF--GKKKRYFFSLRDRKYANGIRPNRAVVSSYWKA 90 6899*********************999..69**********655..77999*********************** PP NAM 86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 tg+dk+++s ++e vg+kk Lvfykgr pkg ktdW+mheyrl Peaxi162Scf00184g00018.1 91 TGTDKAIHS-GSEYVGIKKALVFYKGRPPKGIKTDWIMHEYRL 132 *****.99***************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	7.32E-53	8	158	IPR003441	NAC domain
PROSITE profile	PS51005	49.646	10	159	IPR003441	NAC domain
Pfam	PF02365	5.9E-22	11	132	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 195 aa Download sequence Send to blast
MIEKNSSEKL PPEFRFHPTD EELIMYYLCN QATLRPCPVS IVSVDVYKFD PWELPAEFGK 60 KKRYFFSLRD RKYANGIRPN RAVVSSYWKA TGTDKAIHSG SEYVGIKKAL VFYKGRPPKG 120 IKTDWIMHEY RLSESKSQPT RPNDSMKLDD WVLYRISYLS ITLFWKSSNH LIKLLIKMYS 180 KTKSNISNDM NNHFI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	4e-58	10	156	17	162	NO APICAL MERISTEM PROTEIN
1ut4_B	4e-58	10	156	17	162	NO APICAL MERISTEM PROTEIN
1ut7_A	4e-58	10	156	17	162	NO APICAL MERISTEM PROTEIN
1ut7_B	4e-58	10	156	17	162	NO APICAL MERISTEM PROTEIN
3swm_A	5e-58	10	156	20	165	NAC domain-containing protein 19
3swm_B	5e-58	10	156	20	165	NAC domain-containing protein 19
3swm_C	5e-58	10	156	20	165	NAC domain-containing protein 19
3swm_D	5e-58	10	156	20	165	NAC domain-containing protein 19
3swp_A	5e-58	10	156	20	165	NAC domain-containing protein 19
3swp_B	5e-58	10	156	20	165	NAC domain-containing protein 19
3swp_C	5e-58	10	156	20	165	NAC domain-containing protein 19
3swp_D	5e-58	10	156	20	165	NAC domain-containing protein 19
4dul_A	4e-58	10	156	17	162	NAC domain-containing protein 19
4dul_B	4e-58	10	156	17	162	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269\|PubMed:29760199}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269\|PubMed:29760199}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009781251.1	6e-91	PREDICTED: NAC transcription factor 29-like
Refseq	XP_016451619.1	6e-91	PREDICTED: NAC transcription factor 29-like
Swissprot	K4BNG7	1e-88	NAP2_SOLLC; NAC domain-containing protein 2
TrEMBL	A0A1S3YHB4	1e-89	A0A1S3YHB4_TOBAC; NAC transcription factor 29-like
TrEMBL	A0A1U7WVA7	1e-89	A0A1U7WVA7_NICSY; NAC transcription factor 29-like
STRING	XP_009781251.1	2e-90	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA25137	2	2

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69490.1	3e-80	NAC-like, activated by AP3/PI

Publications ? help Back to Top
Tomato Genome Consortium The tomato genome sequence provides insights into fleshy fruit evolution. Nature, 2012. 485(7400): p. 635-41 [PMID:22660326] Ma X, et al. The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato. Plant Physiol., 2018. 177(3): p. 1286-1302 [PMID:29760199]