![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Peaxi162Scf00192g01413.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
| Family | B3 | ||||||||
| Protein Properties | Length: 71aa MW: 8316.72 Da PI: 10.349 | ||||||||
| Description | B3 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | B3 | 40.6 | 4.6e-13 | 5 | 65 | 17 | 80 |
E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EE CS
B3 17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfv 80
+lpkkfa e+g+ ++++ l+++d + r W++++ ++ +++ ++ W +F+ an+L++gD +
Peaxi162Scf00192g01413.1 5 WLPKKFAMENGLT-NKKFGLIIRDGRQRYWNFRI--YTSGAKVYVGGKWGKFCVANDLQVGDHI 65
59********887.56789***************..88888999******************75 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50863 | 10.884 | 1 | 71 | IPR003340 | B3 DNA binding domain |
| SuperFamily | SSF101936 | 3.53E-12 | 5 | 69 | IPR015300 | DNA-binding pseudobarrel domain |
| Pfam | PF02362 | 1.0E-10 | 5 | 65 | IPR003340 | B3 DNA binding domain |
| CDD | cd10017 | 9.80E-10 | 6 | 65 | No hit | No description |
| Gene3D | G3DSA:2.40.330.10 | 2.2E-10 | 6 | 69 | IPR015300 | DNA-binding pseudobarrel domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 71 aa Download sequence Send to blast |
MKFEWLPKKF AMENGLTNKK FGLIIRDGRQ RYWNFRIYTS GAKVYVGGKW GKFCVANDLQ 60 VGDHIRCEVV T |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009767536.1 | 2e-24 | PREDICTED: B3 domain-containing protein REM10-like | ||||
| Refseq | XP_016504093.1 | 2e-24 | PREDICTED: B3 domain-containing protein REM10-like | ||||
| Refseq | XP_019254323.1 | 2e-24 | PREDICTED: putative B3 domain-containing protein REM4 isoform X1 | ||||
| Refseq | XP_019254325.1 | 2e-24 | PREDICTED: putative B3 domain-containing protein REM4 isoform X1 | ||||
| TrEMBL | A0A1S4CSL3 | 5e-23 | A0A1S4CSL3_TOBAC; B3 domain-containing protein REM10-like | ||||
| TrEMBL | A0A1U7VRG4 | 5e-23 | A0A1U7VRG4_NICSY; B3 domain-containing protein REM10-like | ||||
| STRING | XP_009767536.1 | 9e-24 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA322 | 15 | 171 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G24645.1 | 2e-07 | B3 family protein | ||||




