![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Peaxi162Scf00204g00167.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 92aa MW: 10786.7 Da PI: 10.1846 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 60.7 | 1.8e-19 | 8 | 58 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ie+ ++rqvtfskRr+ + KKAeE+ v Cd++v+ + fs++g++ +++
Peaxi162Scf00204g00167.1 8 KKIEEITKRQVTFSKRRTSLTKKAEEIAVCCDVDVLFVAFSPSGRINKFCT 58
689********************************************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 21.698 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 7.9E-20 | 1 | 59 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-16 | 2 | 22 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 2.88E-23 | 3 | 84 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.3E-19 | 9 | 56 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-16 | 22 | 37 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-16 | 37 | 58 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 92 aa Download sequence Send to blast |
MGRKIEMKKI EEITKRQVTF SKRRTSLTKK AEEIAVCCDV DVLFVAFSPS GRINKFCTKK 60 SIEDFLLRYM NLPVERRLTH IADVQVLHYS IH |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009630259.1 | 4e-49 | PREDICTED: agamous-like MADS-box protein AGL104 | ||||
| Refseq | XP_016446375.1 | 8e-47 | PREDICTED: agamous-like MADS-box protein AGL8 homolog | ||||
| Swissprot | Q9LM46 | 1e-20 | AG104_ARATH; Agamous-like MADS-box protein AGL104 | ||||
| TrEMBL | A0A314LD59 | 7e-47 | A0A314LD59_NICAT; Uncharacterized protein | ||||
| STRING | XP_009630259.1 | 1e-48 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA3785 | 12 | 19 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G22130.1 | 8e-19 | AGAMOUS-like 104 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




