![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Peaxi162Scf00222g00415.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 89aa MW: 10178.1 Da PI: 10.5245 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 59.3 | 4.8e-19 | 10 | 51 | 2 | 43 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
+i n+s r+ tf kR++g++KK +ELS+LC+++++ ii+s+
Peaxi162Scf00222g00415.1 10 FITNDSSRKATFKKRKKGLMKKVSELSTLCGIDACAIIYSPY 51
89**************************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF55455 | 3.01E-25 | 1 | 83 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 4.2E-25 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 17.156 | 1 | 49 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00266 | 1.61E-20 | 2 | 84 | No hit | No description |
| PRINTS | PR00404 | 1.1E-10 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.7E-20 | 10 | 51 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-10 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-10 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
MTRKKVKLAF ITNDSSRKAT FKKRKKGLMK KVSELSTLCG IDACAIIYSP YENQPEVWPN 60 TMGAQRVLAE FKKMPEMEQS KKMAKDCKS |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 2 | 24 | RKKVKLAFITNDSSRKATFKKRK |
| 2 | 21 | 25 | KKRKK |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FJ168510 | 1e-125 | FJ168510.1 Petunia x hybrida type I MADS box transcription factor (MADSy5) gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016464483.1 | 5e-51 | PREDICTED: agamous-like MADS-box protein AGL80 | ||||
| Swissprot | Q9FJK3 | 3e-32 | AGL80_ARATH; Agamous-like MADS-box protein AGL80 | ||||
| TrEMBL | A0A1S3ZJU3 | 1e-49 | A0A1S3ZJU3_TOBAC; agamous-like MADS-box protein AGL80 | ||||
| STRING | POPTR_0005s00420.1 | 8e-47 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA1532 | 23 | 67 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G48670.1 | 1e-34 | AGAMOUS-like 80 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




