![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Peaxi162Scf00347g00712.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 145aa MW: 16217.6 Da PI: 6.3519 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 50.4 | 5e-16 | 10 | 39 | 26 | 55 |
G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55
+AtPk+i+++m+vkgLtl h+kSHLQkYRl
Peaxi162Scf00347g00712.1 10 EATPKAIMRTMGVKGLTLFHLKSHLQKYRL 39
7****************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 2.69E-6 | 9 | 42 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 1.8E-14 | 9 | 40 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 1.6E-10 | 9 | 40 | IPR006447 | Myb domain, plants |
| Pfam | PF14379 | 6.7E-16 | 83 | 128 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 145 aa Download sequence Send to blast |
MHMFSISLAE ATPKAIMRTM GVKGLTLFHL KSHLQKYRLG KQSQKDLDEA SKDGLTATYS 60 LESPCSGGTP QQLPASDLNE GYEVKEALRA QMEVQSKLHL QVEAEKHLQI RQDAEQRYII 120 MLEKACKMLA DQIIGGVVTE NDQET |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}. | |||||
| UniProt | Transcriptional activator (PubMed:26586833). Probable component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). Required for female gametophyte development and function (PubMed:15634699). {ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:26586833}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}. | |||||
| UniProt | INDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AJ719141 | 1e-105 | AJ719141.1 Nicotiana tabacum cDNA-AFLP-fragment BSTT2-32-460, cultivar Bright Yellow 2. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019239694.1 | 2e-89 | PREDICTED: protein PHR1-LIKE 3-like isoform X1 | ||||
| Swissprot | Q8LAJ7 | 3e-36 | PHL3_ARATH; Protein PHR1-LIKE 3 | ||||
| Swissprot | Q94A57 | 3e-36 | PHL2_ARATH; Protein PHR1-LIKE 2 | ||||
| TrEMBL | A0A1J6JSW0 | 4e-88 | A0A1J6JSW0_NICAT; Protein phr1-like 3 | ||||
| STRING | XP_009620524.1 | 1e-88 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA9764 | 20 | 27 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G24120.1 | 1e-38 | G2-like family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




