![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Peaxi162Scf00469g00412.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 79aa MW: 8922.42 Da PI: 10.5757 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 52.9 | 8.2e-17 | 20 | 51 | 24 | 55 |
G2-like 24 sekAtPktilelmkvkgLtlehvkSHLQkYRl 55
+AtPk++le m+vkgL+++h+kSHLQ+YR+
Peaxi162Scf00469g00412.1 20 LGRATPKQVLEQMNVKGLSINHIKSHLQMYRS 51
569****************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 1.97E-6 | 18 | 52 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 5.2E-13 | 20 | 53 | IPR006447 | Myb domain, plants |
| Gene3D | G3DSA:1.10.10.60 | 1.8E-14 | 21 | 52 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 79 aa Download sequence Send to blast |
MSCLLKEKVS KEKDKNQGDL GRATPKQVLE QMNVKGLSIN HIKSHLQMYR SKKLQDAGSV 60 LSPSSRLING KAHLEMYQK |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010657046.1 | 1e-16 | PREDICTED: uncharacterized protein LOC104880828 | ||||
| TrEMBL | A0A438GYS7 | 3e-15 | A0A438GYS7_VITVI; Putative Myb family transcription factor | ||||
| TrEMBL | F6H504 | 4e-16 | F6H504_VITVI; Uncharacterized protein | ||||
| STRING | VIT_12s0028g02080.t01 | 7e-17 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA25336 | 2 | 2 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G42660.1 | 2e-14 | G2-like family protein | ||||




