![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Peaxi162Scf00518g00005.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 70aa MW: 8097.6 Da PI: 10.6851 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 83.7 | 1.1e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+i++ks rqv f+kRr+g+lKKA+ELS+LCd++vav++fs+ g+ly++ss
Peaxi162Scf00518g00005.1 9 KQIQEKSSRQVAFCKRRKGLLKKAKELSILCDVDVAVVVFSNLGRLYDFSS 59
689**********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 3.1E-31 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 3.01E-26 | 1 | 64 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 28.315 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.3E-25 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 8.7E-24 | 11 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.3E-25 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.3E-25 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 70 aa Download sequence Send to blast |
MGRKKVEIKQ IQEKSSRQVA FCKRRKGLLK KAKELSILCD VDVAVVVFSN LGRLYDFSSN 60 NRYAKDVFMI |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 1e-16 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 1e-16 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 1e-16 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 1e-16 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 1e-16 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 1e-16 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 1e-16 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 1e-16 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 1e-16 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 1e-16 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY370524 | 4e-82 | AY370524.1 Petunia x hybrida MADS-box protein 6 (PMADS6) gene, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009795052.1 | 4e-30 | PREDICTED: agamous-like MADS-box protein AGL27 isoform X1 | ||||
| Refseq | XP_009795053.1 | 4e-30 | PREDICTED: agamous-like MADS-box protein AGL27 isoform X2 | ||||
| Refseq | XP_016435771.1 | 4e-30 | PREDICTED: agamous-like MADS-box protein AGL27 isoform X1 | ||||
| Refseq | XP_016435773.1 | 4e-30 | PREDICTED: agamous-like MADS-box protein AGL27 isoform X2 | ||||
| Swissprot | Q2QW53 | 1e-23 | MAD13_ORYSJ; MADS-box transcription factor 13 | ||||
| TrEMBL | Q6UGR1 | 8e-33 | Q6UGR1_PETHY; MADS-box protein 6 (Fragment) | ||||
| STRING | Solyc12g087820.1.1 | 2e-30 | (Solanum lycopersicum) | ||||
| STRING | XP_009795052.1 | 2e-29 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA40 | 24 | 625 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G09960.2 | 5e-26 | MIKC_MADS family protein | ||||




