![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Peaxi162Scf00518g00011.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 94aa MW: 10849.5 Da PI: 10.5685 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 89.1 | 2.3e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krie+ks rqv f+kRr+g+lKKA+ELSvLCd++vav+ifs++g+ly++ss
Peaxi162Scf00518g00011.1 9 KRIEEKSSRQVAFCKRRKGLLKKAKELSVLCDVDVAVVIFSNRGRLYDFSS 59
79***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 29.955 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.8E-34 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 7.46E-28 | 2 | 73 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 3.91E-32 | 2 | 64 | No hit | No description |
| PRINTS | PR00404 | 1.0E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 7.3E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.0E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.0E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 94 aa Download sequence Send to blast |
MGRKKVEIKR IEEKSSRQVA FCKRRKGLLK KAKELSVLCD VDVAVVIFSN RGRLYDFSSN 60 NREKPTKDID HNLNDRDAQV KGKDDKLLNH HIAS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 5e-18 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 5e-18 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 5e-18 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 5e-18 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 5f28_A | 6e-18 | 1 | 64 | 1 | 64 | MEF2C |
| 5f28_B | 6e-18 | 1 | 64 | 1 | 64 | MEF2C |
| 5f28_C | 6e-18 | 1 | 64 | 1 | 64 | MEF2C |
| 5f28_D | 6e-18 | 1 | 64 | 1 | 64 | MEF2C |
| 6c9l_A | 5e-18 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 5e-18 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 5e-18 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 5e-18 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 5e-18 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 5e-18 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY370523 | 3e-99 | AY370523.1 Petunia x hybrida MADS-box protein 17 (PMADS17) gene, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009795052.1 | 2e-31 | PREDICTED: agamous-like MADS-box protein AGL27 isoform X1 | ||||
| Refseq | XP_009795053.1 | 1e-31 | PREDICTED: agamous-like MADS-box protein AGL27 isoform X2 | ||||
| Refseq | XP_016435771.1 | 2e-31 | PREDICTED: agamous-like MADS-box protein AGL27 isoform X1 | ||||
| Refseq | XP_016435773.1 | 1e-31 | PREDICTED: agamous-like MADS-box protein AGL27 isoform X2 | ||||
| Swissprot | Q2QW53 | 3e-27 | MAD13_ORYSJ; MADS-box transcription factor 13 | ||||
| TrEMBL | Q6UGR2 | 7e-34 | Q6UGR2_PETHY; MADS-box protein 17 (Fragment) | ||||
| STRING | XP_009795052.1 | 6e-31 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA40 | 24 | 625 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G14210.1 | 4e-21 | AGAMOUS-like 44 | ||||




