PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Peaxi162Scf00646g00012.1

Organism

Petunia axillaris

Taxonomic ID

33119

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia

Family

GRAS

Protein Properties

Length: 94aa MW: 10823.4 Da PI: 4.244

Description

GRAS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Peaxi162Scf00646g00012.1	genome	SGN	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	GRAS	105.4	7.8e-33	2	93	84	179
GRAS 84 fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakf 168 f+e +P+lk++++++Nq I ea+e+e++vHi+D+++ ++lQW aLl+ L++ pegp++lRiTg ++ +ke l ++++ L++ Peaxi162Scf00646g00012.1 2 FFEFFPFLKVAFMVTNQVIIEAMEEEKMVHIVDLNAAEPLQWQALLHDLSAHPEGPAHLRITGAHQ----QKEVLDQMAQVLTEE 82 9***************************************************************....9********** PP GRAS 169 Aeelgvpfefn 179 A++l+ pf+fn Peaxi162Scf00646g00012.1 83 AANLDFPFQFN 93 ********8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50985	21.491	1	94	IPR005202	Transcription factor GRAS
Pfam	PF03514	2.7E-30	2	93	IPR005202	Transcription factor GRAS

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
MFFEFFPFLK VAFMVTNQVI IEAMEEEKMV HIVDLNAAEP LQWQALLHDL SAHPEGPAHL 60 RITGAHQQKE VLDQMAQVLT EEAANLDFPF QFNE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5b3g_A	2e-16	1	92	101	192	Protein SCARECROW
5b3h_A	2e-16	1	92	100	191	Protein SCARECROW
5b3h_D	2e-16	1	92	100	191	Protein SCARECROW
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in plant development. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG975451	6e-88	HG975451.1 Solanum pennellii chromosome ch12, complete genome.
GenBank	HG975524	6e-88	HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016447393.1	2e-49	PREDICTED: scarecrow-like protein 3
Refseq	XP_019236517.1	2e-49	PREDICTED: scarecrow-like protein 3
Swissprot	Q9LPR8	8e-38	SCL3_ARATH; Scarecrow-like protein 3
TrEMBL	A0A0V0IME1	2e-48	A0A0V0IME1_SOLCH; Putative ovule protein (Fragment)
TrEMBL	A0A1J6JZ68	5e-48	A0A1J6JZ68_NICAT; Scarecrow-like protein 3
TrEMBL	A0A1S3Y561	4e-48	A0A1S3Y561_TOBAC; scarecrow-like protein 3
STRING	XP_009761009.1	2e-48	(Nicotiana sylvestris)
STRING	PGSC0003DMT400011839	2e-48	(Solanum tuberosum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA16041	3	6

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G50420.1	4e-40	scarecrow-like 3

Publications ? help Back to Top
Gong X, et al. SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root. Plant Physiol., 2016. 170(3): p. 1675-83 [PMID:26818732] Lee SA, et al. Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue. Mol Plant, 2016. 9(6): p. 870-84 [PMID:26970019] Choi JW,Lim J Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation. Mol. Cells, 2016. 39(7): p. 524-9 [PMID:27306644]