![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Peinf101Ctg12677271g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 62aa MW: 7065 Da PI: 10.8559 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 22.3 | 3.2e-07 | 3 | 34 | 16 | 47 |
HHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 16 vkqlGggtWktIartmgkgRtlkqcksrwqky 47
+++G+g+W+ I+r + +t+ q+ s+ qky
Peinf101Ctg12677271g00001.1 3 LEKHGKGDWRNISRNFVISKTPTQVASHAQKY 34
68***************789***********9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 13.77 | 1 | 39 | IPR017930 | Myb domain |
| TIGRFAMs | TIGR01557 | 2.0E-9 | 2 | 38 | IPR006447 | Myb domain, plants |
| SuperFamily | SSF46689 | 5.66E-8 | 2 | 38 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 2.0E-5 | 2 | 34 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 6.65E-5 | 2 | 34 | No hit | No description |
| Pfam | PF00249 | 1.1E-5 | 3 | 34 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 62 aa Download sequence Send to blast |
MGLEKHGKGD WRNISRNFVI SKTPTQVASH AQKYYLRQLS GGKDKRRPSI HDITTVNLSN 60 ID |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019267157.1 | 8e-37 | PREDICTED: transcription factor DIVARICATA-like | ||||
| Swissprot | Q8S9H7 | 7e-32 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
| TrEMBL | A0A314KZ48 | 2e-35 | A0A314KZ48_NICAT; Transcription factor myb1r1 | ||||
| STRING | XP_009590398.1 | 6e-36 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA16449 | 5 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G58900.1 | 6e-34 | Homeodomain-like transcriptional regulator | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




