![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Peinf101Ctg12946273g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 100aa MW: 11016.3 Da PI: 6.2465 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 58.2 | 1.8e-18 | 38 | 85 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT Ed +lv++v ++G g+W+++ ++ g+ R++k+c++rw ++l
Peinf101Ctg12946273g00001.1 38 KGPWTSAEDAILVEYVMKHGEGNWNAVQKHSGLARCGKSCRLRWANHL 85
79******************************************9996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 21.425 | 33 | 89 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 8.9E-25 | 36 | 95 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 7.2E-14 | 37 | 87 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.0E-16 | 38 | 85 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 7.77E-20 | 39 | 99 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 8.00E-12 | 40 | 85 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 100 aa Download sequence Send to blast |
NMSITSETDD WMTSKVDMDS PDEANGGGNV GGSLPLKKGP WTSAEDAILV EYVMKHGEGN 60 WNAVQKHSGL ARCGKSCRLR WANHLRPDLK KGAFTLEEER |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 5e-15 | 36 | 100 | 25 | 88 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells. Involved in pollen and floral organs development. May bind to the 5'-TAACAAA-3' box of alpha-amylase promoter. {ECO:0000269|PubMed:9150608}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By gibberellin in aleurone cells. {ECO:0000269|PubMed:9150608}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009762153.1 | 1e-56 | PREDICTED: transcription factor GAMYB-like | ||||
| Refseq | XP_009762156.1 | 1e-56 | PREDICTED: transcription factor GAMYB-like | ||||
| Refseq | XP_009762161.1 | 1e-56 | PREDICTED: transcription factor GAMYB-like | ||||
| Refseq | XP_009762167.1 | 1e-56 | PREDICTED: transcription factor GAMYB-like | ||||
| Refseq | XP_016468034.1 | 1e-56 | PREDICTED: transcription factor GAMYB-like | ||||
| Refseq | XP_016468041.1 | 1e-56 | PREDICTED: transcription factor GAMYB-like | ||||
| Refseq | XP_016468047.1 | 1e-56 | PREDICTED: transcription factor GAMYB-like | ||||
| Refseq | XP_016468055.1 | 1e-56 | PREDICTED: transcription factor GAMYB-like | ||||
| Swissprot | A2WW87 | 2e-41 | GAM1_ORYSI; Transcription factor GAMYB | ||||
| TrEMBL | A0A4D6FBN6 | 2e-64 | A0A4D6FBN6_PETHY; MYB33b | ||||
| STRING | XP_009762153.1 | 5e-56 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA2021 | 23 | 58 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G11440.1 | 4e-39 | myb domain protein 65 | ||||




