 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Peinf101Scf00052g04002.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 72aa MW: 8307.68 Da PI: 11.1358 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 90.7 | 7.5e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
kri+nk rqvtfskRr+g++KKA+ELS+LCd++vav++fs++g+ly++ss
Peinf101Scf00052g04002.1 9 KRIQNKNSRQVTFSKRRKGLIKKAKELSILCDVDVAVVVFSNRGRLYDFSS 59
79***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 2.2E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.83E-29 | 1 | 69 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 30.74 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 5.49E-33 | 2 | 71 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.1E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 5.0E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.1E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.1E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 72 aa Download sequence Send to blast |
MGRKKVEIKR IQNKNSRQVT FSKRRKGLIK KAKELSILCD VDVAVVVFSN RGRLYDFSST 60 NREGVSTTYD KI |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 4e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 4e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 4e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 4e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 4e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 4e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 4e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 4e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 4e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 4e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Prevents premature flowering. Downstream regulator of a subset of the MIKC* MADS-controlled genes required during pollen maturation. {ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:18034896, ECO:0000269|PubMed:18799658}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY370529 | 4e-82 | AY370529.1 Petunia x hybrida MADS-box protein 15 (PMADS15) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019260170.1 | 8e-34 | PREDICTED: agamous-like MADS-box protein AGL27 | ||||
| Swissprot | Q9M2K8 | 5e-26 | AGL18_ARATH; Agamous-like MADS-box protein AGL18 | ||||
| TrEMBL | A0A1S3X7B1 | 5e-32 | A0A1S3X7B1_TOBAC; agamous-like MADS-box protein AGL27 isoform X1 | ||||
| TrEMBL | A0A1S3X7P8 | 4e-32 | A0A1S3X7P8_TOBAC; agamous-like MADS-box protein AGL27 isoform X2 | ||||
| TrEMBL | A0A1U7XSL9 | 5e-32 | A0A1U7XSL9_NICSY; agamous-like MADS-box protein AGL27 isoform X1 | ||||
| TrEMBL | A0A1U7XVV4 | 4e-32 | A0A1U7XVV4_NICSY; agamous-like MADS-box protein AGL27 isoform X2 | ||||
| TrEMBL | A0A1U7Z004 | 3e-32 | A0A1U7Z004_NICSY; agamous-like MADS-box protein AGL27 | ||||
| TrEMBL | A0A314LCH5 | 1e-32 | A0A314LCH5_NICAT; Mads-box transcription factor 57 | ||||
| STRING | XP_009795052.1 | 8e-33 | (Nicotiana sylvestris) | ||||
| STRING | XP_009804704.1 | 5e-33 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA40 | 24 | 625 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G57390.1 | 2e-28 | AGAMOUS-like 18 | ||||
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|