PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00052g06026.1
Organism
Petunia inflata
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family WRKY
Protein Properties Length: 174aa    MW: 20317.8 Da    PI: 9.639
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00052g06026.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.55.8e-3393151159
                               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                               ldDgy+WrKYGqK vk+++fprsYY+Ct++gC+vkk+v+r ++d+ +v++tYeg H h+
  Peinf101Scf00052g06026.1  93 LDDGYRWRKYGQKAVKNNKFPRSYYKCTHQGCNVKKQVQRLSKDEGIVVTTYEGMHSHP 151
                               59********************************************************8 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.8E-3478152IPR003657WRKY domain
SuperFamilySSF1182901.31E-2985151IPR003657WRKY domain
PROSITE profilePS5081129.55188153IPR003657WRKY domain
SMARTSM007741.6E-3893152IPR003657WRKY domain
PfamPF031061.4E-2694151IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MEYYPSNFPF SSSSSSSSHL TLMNMVNNNS HVKEELFMQP KESVETHDER NSFVNCITDD  60
SNKVKTGKKK GDNNKKNKKA RYEFQTRSQV DILDDGYRWR KYGQKAVKNN KFPRSYYKCT  120
HQGCNVKKQV QRLSKDEGIV VTTYEGMHSH PNIEKSSDNF ENILMRQMQM FASC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-2984150874Probable WRKY transcription factor 4
2lex_A6e-2984150874Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009615508.15e-66PREDICTED: probable WRKY transcription factor 75
RefseqXP_016446514.15e-66PREDICTED: probable WRKY transcription factor 75
SwissprotQ9FYA23e-49WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLA0A1S3Y3031e-64A0A1S3Y303_TOBAC; probable WRKY transcription factor 75
STRINGXP_009615508.12e-65(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22042461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.16e-51WRKY DNA-binding protein 75
Publications ? help Back to Top
  1. Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
    DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro.
    Plant Methods, 2010. 6: p. 25
    [PMID:21108821]
  2. Xu L, et al.
    Overexpression of GbWRKY1 positively regulates the Pi starvation response by alteration of auxin sensitivity in Arabidopsis.
    Plant Cell Rep., 2012. 31(12): p. 2177-88
    [PMID:22890372]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Schmiesing A,Emonet A,Gouhier-Darimont C,Reymond P
    Arabidopsis MYC Transcription Factors Are the Target of Hormonal Salicylic Acid/Jasmonic Acid Cross Talk in Response to Pieris brassicae Egg Extract.
    Plant Physiol., 2016. 170(4): p. 2432-43
    [PMID:26884488]
  5. Velasco VM, et al.
    Acclimation of the crucifer Eutrema salsugineum to phosphate limitation is associated with constitutively high expression of phosphate-starvation genes.
    Plant Cell Environ., 2016. 39(8): p. 1818-34
    [PMID:27038434]
  6. Hossain MA, et al.
    Identification of Novel Components of the Unfolded Protein Response in Arabidopsis.
    Front Plant Sci, 2016. 7: p. 650
    [PMID:27242851]
  7. Zhang H,Huang L,Hong Y,Song F
    BOTRYTIS-INDUCED KINASE1, a plasma membrane-localized receptor-like protein kinase, is a negative regulator of phosphate homeostasis in Arabidopsis thaliana.
    BMC Plant Biol., 2016. 16(1): p. 152
    [PMID:27389008]
  8. Zhang S, et al.
    The Arabidopsis Mitochondrial Protease FtSH4 Is Involved in Leaf Senescence via Regulation of WRKY-Dependent Salicylic Acid Accumulation and Signaling.
    Plant Physiol., 2017. 173(4): p. 2294-2307
    [PMID:28250067]
  9. Guo P, et al.
    A Tripartite Amplification Loop Involving the Transcription Factor WRKY75, Salicylic Acid, and Reactive Oxygen Species Accelerates Leaf Senescence.
    Plant Cell, 2017. 29(11): p. 2854-2870
    [PMID:29061866]
  10. Zhang L,Chen L,Yu D
    Transcription Factor WRKY75 Interacts with DELLA Proteins to Affect Flowering.
    Plant Physiol., 2018. 176(1): p. 790-803
    [PMID:29133369]