PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Peinf101Scf00052g06028.1

Organism

Petunia inflata

Taxonomic ID

212142

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia

Family

M-type_MADS

Protein Properties

Length: 111aa MW: 12601.8 Da PI: 10.6715

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Peinf101Scf00052g06028.1	genome	SGN	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	84.1	8.8e-27	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krie+ks rqv f+kRr+g+lKKA+E+S+LCd++vav++fs+ g+ly++ss Peinf101Scf00052g06028.1 9 KRIEEKSSRQVAFCKRRKGLLKKAKEISILCDIDVAVVVFSNLGRLYDFSS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.3E-32	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	28.595	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	6.54E-26	1	66	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.3E-25	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	6.2E-23	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.3E-25	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.3E-25	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 111 aa Download sequence Send to blast
MGRKKVEIKR IEEKSSRQVA FCKRRKGLLK KAKEISILCD IDVAVVVFSN LGRLYDFSSN 60 HSLQGGALIV QAFMKIQGTE QFKGVRGGMS KSQQINNLGY NNRKELIFYL C

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	7e-16	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_Q	7e-16	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_R	7e-16	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_S	7e-16	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_A	7e-16	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_B	7e-16	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_C	7e-16	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_D	7e-16	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_E	7e-16	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_F	7e-16	1	60	1	60	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.
UniProt	Probable transcription factor.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY370523	2e-60	AY370523.1 Petunia x hybrida MADS-box protein 17 (PMADS17) gene, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009795052.1	7e-31	PREDICTED: agamous-like MADS-box protein AGL27 isoform X1
Refseq	XP_009795053.1	6e-31	PREDICTED: agamous-like MADS-box protein AGL27 isoform X2
Refseq	XP_016435771.1	7e-31	PREDICTED: agamous-like MADS-box protein AGL27 isoform X1
Refseq	XP_016435773.1	6e-31	PREDICTED: agamous-like MADS-box protein AGL27 isoform X2
Swissprot	Q2QW53	6e-23	MAD13_ORYSJ; MADS-box transcription factor 13
Swissprot	Q8RU31	5e-23	MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBL	Q6UGR1	3e-31	Q6UGR1_PETHY; MADS-box protein 6 (Fragment)
TrEMBL	Q6UGR2	3e-31	Q6UGR2_PETHY; MADS-box protein 17 (Fragment)
STRING	XP_009795052.1	3e-30	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA24929	2	2

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G14210.1	6e-19	AGAMOUS-like 44

Publications ? help Back to Top
Gindullis F,Rose A,Patel S,Meier I Four signature motifs define the first class of structurally related large coiled-coil proteins in plants. BMC Genomics, 2002. 3: p. 9 [PMID:11972898] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Yamaki S,Satoh H,Nagato Y Gypsy embryo specifies ovule curvature by regulating ovule/integument development in rice. Planta, 2005. 222(3): p. 408-17 [PMID:16001259] Dreni L, et al. The D-lineage MADS-box gene OsMADS13 controls ovule identity in rice. Plant J., 2007. 52(4): p. 690-9 [PMID:17877710] Yamaki S,Nagato Y,Kurata N,Nonomura K Ovule is a lateral organ finally differentiated from the terminating floral meristem in rice. Dev. Biol., 2011. 351(1): p. 208-16 [PMID:21146515] Li H,Liang W,Yin C,Zhu L,Zhang D Genetic interaction of OsMADS3, DROOPING LEAF, and OsMADS13 in specifying rice floral organ identities and meristem determinacy. Plant Physiol., 2011. 156(1): p. 263-74 [PMID:21444646] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949]