![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Peinf101Scf00168g06013.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 139aa MW: 16069.9 Da PI: 9.1731 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 133.6 | 6.6e-42 | 51 | 127 | 1 | 77 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
+Cq+e+C+adls+ak+yh+rhkvCe h+ka+vv+v+gl+qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk++
Peinf101Scf00168g06013.1 51 CCQAEKCTADLSDAKQYHKRHKVCEYHAKAQVVFVTGLRQRFCQQCSRFHELGEFDESKRSCRRRLAGHNERRRKSS 127
6**************************************************************************87 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PIRSF | PIRSF037575 | 1.2E-56 | 1 | 138 | IPR017238 | Squamosa promoter-binding protein |
| Gene3D | G3DSA:4.10.1100.10 | 2.0E-33 | 44 | 113 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 31.975 | 49 | 126 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 3.27E-38 | 50 | 131 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 9.0E-32 | 52 | 125 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009908 | Biological Process | flower development | ||||
| GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 139 aa Download sequence Send to blast |
MEAMEGEVHL EDNDLLILST NDDDKKKRTR NNSTNDKKGC YNNGGSSSVR CCQAEKCTAD 60 LSDAKQYHKR HKVCEYHAKA QVVFVTGLRQ RFCQQCSRFH ELGEFDESKR SCRRRLAGHN 120 ERRRKSSSST TENNQLPRK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 5e-40 | 42 | 125 | 1 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040, ECO:0000305|PubMed:16914499}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KP260635 | 5e-86 | KP260635.1 Nicotiana tabacum SBP-box 4 (SPL4) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009626190.1 | 9e-56 | PREDICTED: squamosa promoter-binding-like protein 4 | ||||
| Refseq | XP_016462352.1 | 9e-56 | PREDICTED: squamosa promoter-binding-like protein 4 | ||||
| Swissprot | Q9S7A9 | 4e-42 | SPL4_ARATH; Squamosa promoter-binding-like protein 4 | ||||
| TrEMBL | A0A2K9ZXU3 | 1e-95 | A0A2K9ZXU3_PETHY; Squamosa promoter-binding-like protein | ||||
| STRING | XP_009626190.1 | 3e-55 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA749 | 24 | 105 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G53160.2 | 8e-40 | squamosa promoter binding protein-like 4 | ||||




