![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Peinf101Scf00255g11050.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 94aa MW: 10303.7 Da PI: 9.5449 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 64 | 3e-20 | 22 | 74 | 5 | 58 |
ZF-HD_dimer 5 rYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
Y eC++N+ a+ ++a+DGC f p g g++ a++C CgCHRnFHRr +
Peinf101Scf00255g11050.1 22 LYGECMRNQLADSMTYATDGCHGFGPG-GPPGSIGAMRCQTCGCHRNFHRRLDT 74
7*************************8.888*******************9765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 3.0E-5 | 17 | 74 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 1.5E-18 | 22 | 71 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 17.701 | 23 | 72 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 1.6E-15 | 23 | 71 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 94 aa Download sequence Send to blast |
MANNNMFRAN KPWANGSITP ALYGECMRNQ LADSMTYATD GCHGFGPGGP PGSIGAMRCQ 60 TCGCHRNFHR RLDTGNHQLP PPSHPRRQKK CGTF |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Putative transcription factor. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015164998.1 | 8e-18 | PREDICTED: zinc-finger homeodomain protein 7-like | ||||
| Swissprot | Q2QW44 | 3e-12 | ZHD3_ORYSJ; Zinc-finger homeodomain protein 3 | ||||
| TrEMBL | A0A314L9L8 | 5e-27 | A0A314L9L8_NICAT; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400095642 | 3e-17 | (Solanum tuberosum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA15336 | 4 | 8 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G74660.1 | 6e-09 | mini zinc finger 1 | ||||




