PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Peinf101Scf00480g12008.1

Organism

Petunia inflata

Taxonomic ID

212142

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia

Family

NAC

Protein Properties

Length: 116aa MW: 13656.9 Da PI: 10.296

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Peinf101Scf00480g12008.1	genome	SGN	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	116.8	2.1e-36	4	116	1	127
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 lpp frFhPtdeel+++yL+++ + +++++ ++i+evd ++ ++k+ yfFs rd+ky++g r+nra+ sgyWka Peinf101Scf00480g12008.1 4 LPPEFRFHPTDEELIMYYLCNQETLRPCPV-SIISEVDA------EF------GKKKRYFFSLRDRKYPNGIRPNRAVVSGYWKA 75 6899************************.88999995......34......56889*********************** PP NAM 86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127 tg+dk+++s +++ vg+kk L+fykgr pkg ktdW++heyr Peinf101Scf00480g12008.1 76 TGTDKAIHS-GSKYVGIKKALMFYKGRPPKGIKTDWIIHEYR 116 *****.99***************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.7E-42	3	116	IPR003441	NAC domain
PROSITE profile	PS51005	32.632	4	116	IPR003441	NAC domain
Pfam	PF02365	5.8E-21	5	116	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 116 aa Download sequence Send to blast
LRKLPPEFRF HPTDEELIMY YLCNQETLRP CPVSIISEVD AEFGKKKRYF FSLRDRKYPN 60 GIRPNRAVVS GYWKATGTDK AIHSGSKYVG IKKALMFYKG RPPKGIKTDW IIHEYR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	1e-44	4	116	15	139	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269\|PubMed:29760199}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269\|PubMed:29760199}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009598866.1	5e-63	PREDICTED: NAC transcription factor 29-like
Refseq	XP_009781251.1	4e-63	PREDICTED: NAC transcription factor 29-like
Refseq	XP_016451619.1	4e-63	PREDICTED: NAC transcription factor 29-like
Refseq	XP_016492232.1	5e-63	PREDICTED: NAC transcription factor 29-like
Swissprot	K4BNG7	1e-61	NAP2_SOLLC; NAC domain-containing protein 2
TrEMBL	A0A1S3YHB4	1e-61	A0A1S3YHB4_TOBAC; NAC transcription factor 29-like
TrEMBL	A0A1S4BTM3	1e-61	A0A1S4BTM3_TOBAC; NAC transcription factor 29-like
TrEMBL	A0A1U7WVA7	1e-61	A0A1U7WVA7_NICSY; NAC transcription factor 29-like
STRING	XP_009781251.1	2e-62	(Nicotiana sylvestris)
STRING	XP_009598866.1	2e-62	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA746	24	103

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69490.1	8e-63	NAC-like, activated by AP3/PI

Publications ? help Back to Top
Tomato Genome Consortium The tomato genome sequence provides insights into fleshy fruit evolution. Nature, 2012. 485(7400): p. 635-41 [PMID:22660326] Ma X, et al. The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato. Plant Physiol., 2018. 177(3): p. 1286-1302 [PMID:29760199]