PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Peinf101Scf00756g01024.1

Organism

Petunia inflata

Taxonomic ID

212142

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia

Family

NF-YB

Protein Properties

Length: 118aa MW: 13231 Da PI: 4.944

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Peinf101Scf00756g01024.1	genome	SGN	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	156.7	4e-49	29	118	3	92
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 eqdr+lPian+srimkk++P+n+ki+kdak+ vqecvsefisf+tseasdkcqre+rkting dll a+ lGfedyv+plk++l Peinf101Scf00756g01024.1 29 EQDRLLPIANISRIMKKAIPSNGKIAKDAKDAVQECVSEFISFITSEASDKCQRERRKTINGYDLLLAMLALGFEDYVDPLKMFL 113 8********************************************************************************** PP NF-YB 88 kkyre 92 +y e Peinf101Scf00756g01024.1 114 DRYTE 118 *76 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.2E-45	25	118	IPR009072	Histone-fold
SuperFamily	SSF47113	1.71E-34	30	118	IPR009072	Histone-fold
Pfam	PF00808	1.3E-26	33	97	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	1.3E-16	61	79	No hit	No description
PROSITE pattern	PS00685	0	64	80	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	1.3E-16	80	98	No hit	No description
PRINTS	PR00615	1.3E-16	99	117	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 118 aa Download sequence Send to blast
MADDHQGSAN SHESDEHSPP PIGSKNICEQ DRLLPIANIS RIMKKAIPSN GKIAKDAKDA 60 VQECVSEFIS FITSEASDKC QRERRKTING YDLLLAMLAL GFEDYVDPLK MFLDRYTE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	4e-43	29	118	3	92	Transcription factor HapC (Eurofung)
4g92_B	4e-43	29	118	3	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269\|PubMed:14617083}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021622196.1	2e-56	nuclear transcription factor Y subunit B-10-like isoform X1
Refseq	XP_021622197.1	2e-56	nuclear transcription factor Y subunit B-10-like isoform X2
Swissprot	Q5QMG3	6e-51	NFYB2_ORYSJ; Nuclear transcription factor Y subunit B-2
TrEMBL	A0A251KLG8	3e-55	A0A251KLG8_MANES; Uncharacterized protein
STRING	cassava4.1_017418m	6e-56	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA25100	2	2

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G37060.3	1e-52	nuclear factor Y, subunit B8