![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Peinf101Scf09408g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 82aa MW: 9104.29 Da PI: 8.2673 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 63.5 | 4.1e-20 | 10 | 55 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+g+W++eEd l+++v q+G+++W++I+ ++ gR++k+c++rw +
Peinf101Scf09408g00001.1 10 KGSWSPEEDNMLIKLVDQHGPRNWSLISTGIP-GRSGKSCRLRWCNQ 55
799*****************************.***********985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 26.428 | 5 | 60 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.4E-16 | 9 | 58 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.1E-19 | 10 | 55 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 5.2E-22 | 10 | 55 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.76E-21 | 11 | 82 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 7.71E-17 | 12 | 54 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 9.6E-7 | 56 | 82 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 7.182 | 61 | 82 | IPR017930 | Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 82 aa Download sequence Send to blast |
MEGTTGDKIK GSWSPEEDNM LIKLVDQHGP RNWSLISTGI PGRSGKSCRL RWCNQLSPTV 60 QHRPFTPSED AIILQAHALH GN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1gv2_A | 2e-21 | 9 | 82 | 3 | 76 | MYB PROTO-ONCOGENE PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019262180.1 | 8e-48 | PREDICTED: myb protein-like | ||||
| Swissprot | O23160 | 5e-34 | MYB73_ARATH; Transcription factor MYB73 | ||||
| TrEMBL | A0A314L8L3 | 2e-46 | A0A314L8L3_NICAT; Transcription factor myb44 | ||||
| STRING | XP_009785340.1 | 8e-47 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA12883 | 16 | 20 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G37260.1 | 2e-36 | myb domain protein 73 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




