![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Peinf101Scf18903g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 162aa MW: 18822.8 Da PI: 9.3077 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 188.2 | 1.8e-58 | 22 | 149 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85
lppGfrFhPtdee++++yL++kv +k++++ +++evd++k+ePwdLp+k+k +ekewyfF++rd+ky+tg r+nrat+sgyWka
Peinf101Scf18903g00001.1 22 LPPGFRFHPTDEEIITCYLQEKVMDKRFTA-IAVAEVDLNKSEPWDLPAKAKMGEKEWYFFCQRDRKYPTGMRTNRATESGYWKA 105
79*************************999.88***************99999******************************** PP
NAM 86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
tgkdke+++ kg lvg+kktLvfykgrapkgekt+Wvmheyrle
Peinf101Scf18903g00001.1 106 TGKDKEIYKGKGCLVGMKKTLVFYKGRAPKGEKTNWVMHEYRLE 149
*********9********************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 6.41E-61 | 18 | 156 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 54.633 | 22 | 162 | IPR003441 | NAC domain |
| Pfam | PF02365 | 8.0E-31 | 23 | 148 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 162 aa Download sequence Send to blast |
MGTPVLPMQV INQESDHDIL NLPPGFRFHP TDEEIITCYL QEKVMDKRFT AIAVAEVDLN 60 KSEPWDLPAK AKMGEKEWYF FCQRDRKYPT GMRTNRATES GYWKATGKDK EIYKGKGCLV 120 GMKKTLVFYK GRAPKGEKTN WVMHEYRLEG KLSYNCFHKA AM |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 3e-52 | 13 | 148 | 7 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 3e-52 | 13 | 148 | 7 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 3e-52 | 13 | 148 | 7 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 3e-52 | 13 | 148 | 7 | 142 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 2e-52 | 13 | 148 | 10 | 145 | NAC domain-containing protein 19 |
| 3swm_B | 2e-52 | 13 | 148 | 10 | 145 | NAC domain-containing protein 19 |
| 3swm_C | 2e-52 | 13 | 148 | 10 | 145 | NAC domain-containing protein 19 |
| 3swm_D | 2e-52 | 13 | 148 | 10 | 145 | NAC domain-containing protein 19 |
| 3swp_A | 2e-52 | 13 | 148 | 10 | 145 | NAC domain-containing protein 19 |
| 3swp_B | 2e-52 | 13 | 148 | 10 | 145 | NAC domain-containing protein 19 |
| 3swp_C | 2e-52 | 13 | 148 | 10 | 145 | NAC domain-containing protein 19 |
| 3swp_D | 2e-52 | 13 | 148 | 10 | 145 | NAC domain-containing protein 19 |
| 4dul_A | 3e-52 | 13 | 148 | 7 | 142 | NAC domain-containing protein 19 |
| 4dul_B | 3e-52 | 13 | 148 | 7 | 142 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF510214 | 0.0 | AF510214.1 Petunia x hybrida nam-like protein 17 (NH17) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009587307.1 | 1e-101 | PREDICTED: NAC domain-containing protein 79-like isoform X1 | ||||
| Refseq | XP_016471991.1 | 1e-101 | PREDICTED: NAC domain-containing protein 79-like | ||||
| Refseq | XP_018622492.1 | 1e-101 | PREDICTED: NAC domain-containing protein 92-like isoform X2 | ||||
| Swissprot | Q9FK44 | 5e-89 | NAC87_ARATH; NAC domain-containing protein 87 | ||||
| TrEMBL | A0A1S4A5Z6 | 1e-100 | A0A1S4A5Z6_TOBAC; NAC domain-containing protein 79-like | ||||
| STRING | XP_009587307.1 | 1e-101 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA152 | 24 | 279 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G18270.2 | 4e-92 | Arabidopsis NAC domain containing protein 87 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




