![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Peinf101Scf19371g00002.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 99aa MW: 11210.9 Da PI: 8.7568 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 128.7 | 2.6e-40 | 11 | 97 | 1 | 87 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87
+CaaCk+l+r+C+++C +apyf +++pkkfa+vhk+FGasnv+k+l+++pe++red+++slvyeAe+r+rdPvyG++g i +lq+++
Peinf101Scf19371g00002.1 11 SCAACKFLKRRCTPNCQFAPYFRSDEPKKFAIVHKVFGASNVSKILNEVPEDQREDTVNSLVYEAEVRLRDPVYGCIGAIASLQRKM 97
6***********************************************************************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 24.698 | 10 | 99 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 1.7E-39 | 11 | 97 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 99 aa Download sequence Send to blast |
MKSHEPRSSS SCAACKFLKR RCTPNCQFAP YFRSDEPKKF AIVHKVFGAS NVSKILNEVP 60 EDQREDTVNS LVYEAEVRLR DPVYGCIGAI ASLQRKMVE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 2e-43 | 6 | 97 | 6 | 97 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 2e-43 | 6 | 97 | 6 | 97 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009786680.1 | 6e-66 | PREDICTED: LOB domain-containing protein 21-like | ||||
| Refseq | XP_016497209.1 | 7e-66 | PREDICTED: LOB domain-containing protein 21-like | ||||
| Swissprot | Q9SRL8 | 7e-55 | LBD21_ARATH; LOB domain-containing protein 21 | ||||
| TrEMBL | A0A1S4C8C5 | 2e-64 | A0A1S4C8C5_TOBAC; LOB domain-containing protein 21-like | ||||
| TrEMBL | A0A1U7XJL5 | 1e-64 | A0A1U7XJL5_NICSY; LOB domain-containing protein 21-like | ||||
| STRING | XP_009786680.1 | 2e-65 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA43 | 24 | 669 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G11090.1 | 3e-57 | LOB domain-containing protein 21 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




