PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pgl001215

Organism

Picea glauca

Taxonomic ID

3330

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea

Family

NAC

Protein Properties

Length: 177aa MW: 20204 Da PI: 7.0731

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Pgl#S25726235	PU_ref	Unigene	View CDS
gnl\|UG\|Pgl#S40975352	PU_unref	Unigene	View CDS
PUT-175a-Picea_glauca-25091	PU_unref	plantGDB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	158.4	2.9e-49	16	142	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100 lp GfrF+Ptdeel+ +yLkkkv+++++++ ++i+e+d y+++PwdLp+k+ +ekewyfFs+rd+ky ++ r+nr++ sgyWkatg+dk+++ +++++v Pgl001215 16 LPTGFRFDPTDEELLIHYLKKKVSSSPFPA-SIIAEIDPYSHDPWDLPAKAFFGEKEWYFFSPRDRKYLNEARPNRSAGSGYWKATGTDKSIVITSSQKV 114 799*************************.89***********8777899***************************************** PP NAM 101 glkktLvfykgrapkgektdWvmheyrl 128 g+kk+Lvfy+g +g kt+W+mhey l Pgl001215 115 GVKKSLVFYTGMPLEGLKTNWIMHEYGL 142 ************************76 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	3.14E-54	11	146	IPR003441	NAC domain
PROSITE profile	PS51005	50.114	16	160	IPR003441	NAC domain
Pfam	PF02365	4.7E-27	17	141	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 177 aa Download sequence Send to blast
MTIDGLPFHQ QLLPQLPTGF RFDPTDEELL IHYLKKKVSS SPFPASIIAE IDPYSHDPWD 60 LPAKAFFGEK EWYFFSPRDR KYLNEARPNR SAGSGYWKAT GTDKSIVITS SQKVGVKKSL 120 VFYTGMPLEG LKTNWIMHEY GLAETLPSER KGSMLDIRES ESFFHGCFVL GFRDTVT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	4e-59	16	153	17	151	NO APICAL MERISTEM PROTEIN
1ut4_B	4e-59	16	153	17	151	NO APICAL MERISTEM PROTEIN
1ut7_A	4e-59	16	153	17	151	NO APICAL MERISTEM PROTEIN
1ut7_B	4e-59	16	153	17	151	NO APICAL MERISTEM PROTEIN
3swm_A	5e-59	16	153	20	154	NAC domain-containing protein 19
3swm_B	5e-59	16	153	20	154	NAC domain-containing protein 19
3swm_C	5e-59	16	153	20	154	NAC domain-containing protein 19
3swm_D	5e-59	16	153	20	154	NAC domain-containing protein 19
3swp_A	5e-59	16	153	20	154	NAC domain-containing protein 19
3swp_B	5e-59	16	153	20	154	NAC domain-containing protein 19
3swp_C	5e-59	16	153	20	154	NAC domain-containing protein 19
3swp_D	5e-59	16	153	20	154	NAC domain-containing protein 19
4dul_A	4e-59	16	153	17	151	NAC domain-containing protein 19
4dul_B	4e-59	16	153	17	151	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269\|PubMed:18849494, ECO:0000269\|PubMed:24363315}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269\|PubMed:24363315, ECO:0000269\|PubMed:24659488}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011098344.1	6e-67	NAC transcription factor 56
Swissprot	Q84TD6	1e-64	NAC47_ARATH; NAC transcription factor 47
TrEMBL	D5ABS0	3e-92	D5ABS0_PICSI; Uncharacterized protein
STRING	XP_007149615.1	4e-65	(Phaseolus vulgaris)
STRING	A0A087H6U0	3e-65	(Arabis alpina)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G04070.2	7e-66	NAC domain containing protein 47

Publications ? help Back to Top
Hofmann NR A NAC transcription factor for flooding: SHYG helps plants keep their leaves in the air. Plant Cell, 2013. 25(12): p. 4771 [PMID:24363314] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]