![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pgl016927 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
| Family | HB-other | ||||||||
| Protein Properties | Length: 108aa MW: 13114.7 Da PI: 10.161 | ||||||||
| Description | HB-other family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 55.9 | 7.2e-18 | 23 | 78 | 2 | 57 |
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
kR t++qle Le+ ++yps++ r++L+++lgL++rq ++WF+ rR k+kk
Pgl016927 23 TKRKMKTPTQLELLEKNLWDDNYPSESVRADLSSQLGLSDRQLQIWFCHRRLKDKK 78
58999*************************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.8E-17 | 8 | 79 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.46E-16 | 13 | 79 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50071 | 16.131 | 19 | 79 | IPR001356 | Homeobox domain |
| SMART | SM00389 | 1.0E-14 | 21 | 83 | IPR001356 | Homeobox domain |
| CDD | cd00086 | 4.20E-10 | 24 | 73 | No hit | No description |
| Pfam | PF00046 | 2.2E-15 | 24 | 78 | IPR001356 | Homeobox domain |
| PROSITE pattern | PS00027 | 0 | 54 | 77 | IPR017970 | Homeobox, conserved site |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 108 aa Download sequence Send to blast |
MELEGERKLQ PQPPSSSQED KNTKRKMKTP TQLELLEKNL WDDNYPSESV RADLSSQLGL 60 SDRQLQIWFC HRRLKDKKER EKEKEKEKEK EKEKEKEKEK QLKKKKKX |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 71 | 78 | RRLKDKKE |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Highly expressed in growing tissues such as inflorescence and flower meristems, young leaves and floral organs. Expressed in roots, rosette and cauline leaves, stems, flowers, inflorescences and siliques. {ECO:0000269|PubMed:22694359}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC (PubMed:22694359). Involved in the transcriptional regulation of seed-specific gene expression (PubMed:23872538). {ECO:0000269|PubMed:22694359, ECO:0000269|PubMed:23872538}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024398533.1 | 1e-22 | homeobox-DDT domain protein RLT2-like isoform X1 | ||||
| Refseq | XP_024398535.1 | 1e-22 | homeobox-DDT domain protein RLT2-like isoform X1 | ||||
| Refseq | XP_024398536.1 | 1e-22 | homeobox-DDT domain protein RLT2-like isoform X1 | ||||
| Refseq | XP_024398537.1 | 1e-22 | homeobox-DDT domain protein RLT2-like isoform X1 | ||||
| Refseq | XP_024398538.1 | 1e-22 | homeobox-DDT domain protein RLT2-like isoform X1 | ||||
| Refseq | XP_024398539.1 | 1e-22 | homeobox-DDT domain protein RLT2-like isoform X2 | ||||
| Swissprot | Q9FFH1 | 4e-19 | RLT2_ARATH; Homeobox-DDT domain protein RLT2 | ||||
| TrEMBL | A0A176VF77 | 6e-22 | A0A176VF77_MARPO; Uncharacterized protein | ||||
| TrEMBL | A0A2R6XQZ3 | 6e-22 | A0A2R6XQZ3_MARPO; Uncharacterized protein | ||||
| STRING | PP1S15_37V6.1 | 5e-22 | (Physcomitrella patens) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G44180.1 | 2e-19 | Homeodomain-like transcriptional regulator | ||||




