![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Phvul.001G175700.1 | ||||||||
| Common Name | PHAVU_001G175700g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 84aa MW: 9179.87 Da PI: 10.6282 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 135.8 | 1e-42 | 19 | 83 | 6 | 70 |
S1FA 6 veakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
+ +G+nPGlivllvvgglll+fl+gn++ly+yaqk+lPPrkkkPvskkk+k+e+lkqGv++PGe
Phvul.001G175700.1 19 ASNQGFNPGLIVLLVVGGLLLTFLIGNFVLYTYAQKTLPPRKKKPVSKKKMKKERLKQGVSAPGE 83
5569************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04689 | 3.4E-40 | 20 | 83 | IPR006779 | DNA binding protein S1FA |
| ProDom | PD019013 | 1.0E-5 | 22 | 83 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 84 aa Download sequence Send to blast |
MADDFEFADK VPPSFDRVAS NQGFNPGLIV LLVVGGLLLT FLIGNFVLYT YAQKTLPPRK 60 KKPVSKKKMK KERLKQGVSA PGE* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Phvul.001G175700.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015037 | 5e-88 | AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007162731.1 | 1e-53 | hypothetical protein PHAVU_001G175700g | ||||
| Swissprot | Q7XLX6 | 2e-14 | S1FA2_ORYSJ; DNA-binding protein S1FA2 | ||||
| TrEMBL | V7CZP4 | 3e-52 | V7CZP4_PHAVU; Uncharacterized protein | ||||
| STRING | XP_007162731.1 | 5e-53 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF5409 | 33 | 55 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G09735.1 | 5e-09 | S1FA-like DNA-binding protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Phvul.001G175700.1 |
| Entrez Gene | 18641727 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




