![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Phvul.002G100500.1 | ||||||||
| Common Name | PHAVU_002G100500g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 113aa MW: 12616.8 Da PI: 9.1652 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 73.4 | 4.4e-23 | 58 | 104 | 1 | 47 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllk 47
+CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvh++FGasn+ k+l+
Phvul.002G100500.1 58 PCAACKLLRRRCAQDCVFAPYFPADEPHKFANVHRVFGASNINKMLQ 104
7********************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 17.125 | 57 | 112 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 3.6E-22 | 58 | 104 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 113 aa Download sequence Send to blast |
MQASSIPSLS LLPFTFLHFI FSYKSFSFLL CHSHVLIELH NNKGNMKDGG RKQGAPSPCA 60 ACKLLRRRCA QDCVFAPYFP ADEPHKFANV HRVFGASNIN KMLQVHSLCC LY* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 7e-21 | 54 | 103 | 7 | 56 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 7e-21 | 54 | 103 | 7 | 56 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Phvul.002G100500.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015034 | 1e-100 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007157815.1 | 2e-78 | hypothetical protein PHAVU_002G100500g | ||||
| Swissprot | Q9SHE9 | 4e-33 | LBD4_ARATH; LOB domain-containing protein 4 | ||||
| TrEMBL | V7CI67 | 4e-77 | V7CI67_PHAVU; Uncharacterized protein | ||||
| STRING | XP_007157815.1 | 7e-78 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1334 | 34 | 105 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G31320.1 | 2e-35 | LOB domain-containing protein 4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Phvul.002G100500.1 |
| Entrez Gene | 18637509 |




