PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G163500.1
Common NamePHAVU_002G163500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 82aa    MW: 9430.68 Da    PI: 9.124
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G163500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.33.2e-072362445
                        S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                        ++++E++l+ +  k+ G + W++Ia +++ gR ++++  +w 
  Phvul.002G163500.1 23 MSEQEEDLIHRMYKLVGDK-WNLIAGRIP-GRKAEEIERFWI 62
                        589**************99.*********.*********995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00551967IPR001005SANT/Myb domain
CDDcd001671.27E-42361No hitNo description
PfamPF002491.7E-62462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-102462IPR009057Homeodomain-like
SuperFamilySSF466896.47E-72462IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009913Biological Processepidermal cell differentiation
GO:0010063Biological Processpositive regulation of trichoblast fate specification
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 82 aa     Download sequence    Send to blast
MSTTATSTTS EEVSSKEWKV IHMSEQEEDL IHRMYKLVGD KWNLIAGRIP GRKAEEIERF  60
WIMRHTHAFS VTTNQSKAKH S*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Determines the fate of epidermal cell differentiation. Represses trichome development by lateral inhibition. Together with GL3 or BHLH2, promotes the formation of hair developing cells (H position) in root epidermis, probably by inhibiting non-hair cell formation. Represses the expression of GL2 and WER in H cells. Positively regulates stomatal formation in the hypocotyl (PubMed:19513241). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:12356720, ECO:0000269|PubMed:16291794, ECO:0000269|PubMed:19513241, ECO:0000269|PubMed:9262483}.
UniProtTranscription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.002G163500.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}.
UniProtINDUCTION: Transcriptional repression correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in root epidermis N cells (non-hair developing cells). Induced by WER. Negative autoregulation by interfering with the binding of WER to its WER-binding sites (WBS) promoter region, especially in H cells. Down-regulated by GEM. Down-regulated by TMM (PubMed:19513241). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16176989, ECO:0000269|PubMed:16207757, ECO:0000269|PubMed:17450124, ECO:0000269|PubMed:19513241}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2381152e-75KP238115.1 Lablab purpureus caprice (cpc) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007158570.11e-53hypothetical protein PHAVU_002G163500g
SwissprotO220593e-28CPC_ARATH; Transcription factor CPC
SwissprotQ8GV053e-28TRY_ARATH; Transcription factor TRY
TrEMBLV7CKA12e-52V7CKA1_PHAVU; Uncharacterized protein
STRINGXP_007158570.14e-53(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35832757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53200.11e-26MYB_related family protein
Publications ? help Back to Top
  1. Perazza D, et al.
    Trichome cell growth in Arabidopsis thaliana can be derepressed by mutations in at least five genes.
    Genetics, 1999. 152(1): p. 461-76
    [PMID:10224275]
  2. Scheres B
    Plant patterning: TRY to inhibit your neighbors.
    Curr. Biol., 2002. 12(23): p. R804-6
    [PMID:12477405]
  3. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  4. Brininstool G, et al.
    Constitutive Expressor Of Pathogenesis-related Genes5 affects cell wall biogenesis and trichome development.
    BMC Plant Biol., 2008. 8: p. 58
    [PMID:18485217]
  5. Savage N, et al.
    Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana.
    PLoS ONE, 2013. 8(10): p. e75452
    [PMID:24130712]
  6. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  7. Xue XY, et al.
    Interaction between two timing microRNAs controls trichome distribution in Arabidopsis.
    PLoS Genet., 2014. 10(4): p. e1004266
    [PMID:24699192]
  8. Nayidu NK, et al.
    Comparison of five major trichome regulatory genes in Brassica villosa with orthologues within the Brassicaceae.
    PLoS ONE, 2014. 9(4): p. e95877
    [PMID:24755905]
  9. Taheri A, et al.
    A landscape of hairy and twisted: hunting for new trichome mutants in the Saskatoon Arabidopsis T-DNA population.
    Plant Biol (Stuttg), 2015. 17(2): p. 384-94
    [PMID:25348773]
  10. Wada T,Hayashi N,Tominaga-Wada R
    Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis.
    Plant Signal Behav, 2015. 10(11): p. e1089372
    [PMID:26339713]
  11. Huang M,Hu Y,Liu X,Li Y,Hou X
    Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development.
    Front Plant Sci, 2015. 6: p. 955
    [PMID:26579186]
  12. Wada T,Tominaga-Wada R
    CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression.
    Plant Sci., 2015. 241: p. 260-5
    [PMID:26706076]
  13. Tominaga-Wada R,Wada T
    The ectopic localization of CAPRICE LIKE MYB3 protein in Arabidopsis root epidermis.
    J. Plant Physiol., 2016. 199: p. 111-115
    [PMID:27302012]
  14. Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R
    The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells.
    Plant J., 2016. 88(5): p. 762-774
    [PMID:27496682]
  15. Tominaga-Wada R,Kurata T,Wada T
    Localization of ENHANCER OF TRY AND CPC1 protein in Arabidopsis root epidermis.
    J. Plant Physiol., 2017. 214: p. 48-52
    [PMID:28437677]
  16. Tominaga-Wada R,Kurata T,Wada T
    Localization of the CAPRICE-ENHANCER OF TRY AND CPC1 chimera protein in Arabidopsis root epidermis.
    Biosci. Biotechnol. Biochem., 2017. 81(9): p. 1762-1767
    [PMID:28644769]
  17. Tian H, et al.
    NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1.
    Plant Physiol., 2017. 174(4): p. 2363-2375
    [PMID:28649093]
  18. Tominaga-Wada R,Wada T
    Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation.
    Development, 2017. 144(13): p. 2375-2380
    [PMID:28676568]
  19. Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA
    Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana.
    Plant J., 2017. 92(2): p. 305-316
    [PMID:28771873]
  20. Tominaga-Wada R,Wada T
    Effect of amino acid substitution of CAPRICE on cell-to-cell movement ability in Arabidopsis root epidermis.
    Dev. Biol., 2018. 435(1): p. 1-5
    [PMID:29337129]
  21. Kohanová J, et al.
    Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots.
    Ann. Bot., 2018. 122(5): p. 903-914
    [PMID:29394308]
  22. Yamada K,Sasabe M,Fujikawa Y,Wada T,Tominaga-Wada R
    Amino acid substitutions in CPC-LIKE MYB reveal residues important for protein stability in Arabidopsis roots.
    PLoS ONE, 2018. 13(10): p. e0205522
    [PMID:30308079]
  23. Kribii R, et al.
    Cloning and characterization of the Arabidopsis thaliana SQS1 gene encoding squalene synthase--involvement of the C-terminal region of the enzyme in the channeling of squalene through the sterol pathway.
    Eur. J. Biochem., 1997. 249(1): p. 61-9
    [PMID:9363754]