![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Phvul.003G067500.1 | ||||||||
| Common Name | PHAVU_003G067500g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
| Family | bHLH | ||||||||
| Protein Properties | Length: 94aa MW: 10443.9 Da PI: 10.0251 | ||||||||
| Description | bHLH family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HLH | 27.8 | 4.5e-09 | 21 | 60 | 15 | 54 |
HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
+i + ++L++l+P++ + +s K+s + +L+++++YIksL
Phvul.003G067500.1 21 QITDLVSKLQQLIPELRARRSDKVSASKVLQETCNYIKSL 60
6889999********879*********************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50888 | 9.623 | 6 | 60 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| SuperFamily | SSF47459 | 1.7E-9 | 21 | 82 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene3D | G3DSA:4.10.280.10 | 4.0E-9 | 21 | 75 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Pfam | PF00010 | 1.6E-6 | 21 | 60 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 94 aa Download sequence Send to blast |
MSTRRSRSRQ SPVSTEITDA QITDLVSKLQ QLIPELRARR SDKVSASKVL QETCNYIKSL 60 HREVDDLSDR LSQLLATTDS NSAQAAIIRS LLM* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that regulates light-mediated responses in day light conditions by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. Forms non-functional heterodimers with HFR1, causing liberation and activation of PIF4 from the transcriptionally inactive HFR1-PIF4 complex. {ECO:0000269|PubMed:16786307, ECO:0000269|PubMed:23224238}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Phvul.003G067500.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian regulation with a peak of expression at midday. {ECO:0000269|PubMed:16786307}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007153819.1 | 5e-59 | hypothetical protein PHAVU_003G067500g | ||||
| Swissprot | Q8GW32 | 4e-39 | PRE6_ARATH; Transcription factor PRE6 | ||||
| TrEMBL | V7C8Y0 | 1e-57 | V7C8Y0_PHAVU; Uncharacterized protein | ||||
| STRING | XP_007153819.1 | 2e-58 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF567 | 34 | 143 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G26945.1 | 2e-41 | bHLH family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Phvul.003G067500.1 |
| Entrez Gene | 18634111 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




