PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Phvul.004G065400.1

Common Name

PHAVU_004G065400g

Organism

Phaseolus vulgaris

Taxonomic ID

3885

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus

Family

MYB_related

Protein Properties

Length: 104aa MW: 12090.7 Da PI: 10.339

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Phvul.004G065400.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	31.8	3.4e-10	22	67	3	48
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rWT+ E+ l++ + + +g+Wk+I+++ +t q+ s+ qky+ Phvul.004G065400.1 22 RWTENEHRLFLIGLQNCSPGDWKSISKRYIPSKTSTQIASHAQKYM 67 9***********************98877***********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.3E-8	13	77	IPR009057	Homeodomain-like
PROSITE profile	PS51294	10.055	15	71	IPR017930	Myb domain
SuperFamily	SSF46689	3.36E-14	17	71	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	1.9E-12	18	67	IPR006447	Myb domain, plants
SMART	SM00717	0.0031	19	69	IPR001005	SANT/Myb domain
CDD	cd00167	9.32E-6	22	67	No hit	No description
Pfam	PF00249	9.0E-8	22	66	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 104 aa Download sequence Send to blast
MPNYLNHSTP PVSKSHHKRY ERWTENEHRL FLIGLQNCSP GDWKSISKRY IPSKTSTQIA 60 SHAQKYMHYQ NGLKKNKKRK SIHDVTLDDI NTSVVPSFIN QEQ*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269\|PubMed:26243618}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Phvul.004G065400.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:26243618}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007151661.1	9e-73	hypothetical protein PHAVU_004G065400g
Swissprot	Q9FNN6	3e-20	SRM1_ARATH; Transcription factor SRM1
TrEMBL	V7C308	2e-71	V7C308_PHAVU; Uncharacterized protein
STRING	XP_007151661.1	4e-72	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF18526	2	5

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G04760.1	4e-26	MYB family protein

Link Out ? help Back to Top
Phytozome	Phvul.004G065400.1
Entrez Gene	18632225

Publications ? help Back to Top
Wang T, et al. Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1027-41 [PMID:26243618] Chen YS, et al. Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis. Plant Mol. Biol., 2017. 93(3): p. 299-311 [PMID:27866313]