![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Phvul.006G034400.3 | ||||||||
| Common Name | PHAVU_006G034400g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 85aa MW: 9678.07 Da PI: 10.2749 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 101.3 | 3.7e-32 | 24 | 74 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+lyey++
Phvul.006G034400.3 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYAN 74
79***********************************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF55455 | 9.68E-31 | 16 | 79 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 33.824 | 16 | 76 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 4.6E-42 | 16 | 75 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 3.61E-40 | 17 | 75 | No hit | No description |
| PRINTS | PR00404 | 7.4E-34 | 18 | 38 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 18 | 72 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.1E-27 | 25 | 72 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.4E-34 | 38 | 53 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.4E-34 | 53 | 74 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 85 aa Download sequence Send to blast |
MELPNQAQEG SSQKKMGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL 60 VVFSSRGRLY EYANNRLYQH TNPS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 4e-22 | 16 | 77 | 1 | 62 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 4e-22 | 16 | 77 | 1 | 62 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 4e-22 | 16 | 77 | 1 | 62 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 4e-22 | 16 | 77 | 1 | 62 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 4e-22 | 16 | 77 | 1 | 62 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 4e-22 | 16 | 77 | 1 | 62 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 4e-22 | 16 | 77 | 1 | 62 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 4e-22 | 16 | 77 | 1 | 62 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 4e-22 | 16 | 77 | 1 | 62 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 4e-22 | 16 | 77 | 1 | 62 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}. | |||||
| UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. | |||||
| UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Phvul.006G034400.3 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015038 | 1e-127 | AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007146364.1 | 4e-57 | hypothetical protein PHAVU_006G034400g | ||||
| Swissprot | P29381 | 1e-38 | AGL1_ARATH; Agamous-like MADS-box protein AGL1 | ||||
| Swissprot | Q40885 | 1e-38 | AG_PETHY; Floral homeotic protein AGAMOUS | ||||
| Swissprot | Q43585 | 1e-38 | AG_TOBAC; Floral homeotic protein AGAMOUS | ||||
| TrEMBL | V7BMU3 | 9e-56 | V7BMU3_PHAVU; Uncharacterized protein | ||||
| STRING | XP_007146364.1 | 1e-56 | (Phaseolus vulgaris) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G58780.2 | 8e-42 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Phvul.006G034400.3 |
| Entrez Gene | 18627663 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




